KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_1347Help
Entry
Clo1313_1347      CDS       T01933                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ctx01100  Metabolic pathways
ctx01110  Biosynthesis of secondary metabolites
ctx01130  Biosynthesis of antibiotics
ctx01230  Biosynthesis of amino acids
Module
ctx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Clo1313_1347
Enzymes [BR:ctx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Clo1313_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth NanE PDZ FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADU74410
Position
1593608..1594390
Genome map
AA seq 260 aa AA seqDB search
MILDEIVAQKKIQLKKDMSRITIEGWKQKIKRPGIHKPLDFYGALKNNGDISIIAEVKKA
SPSKGIIKEDFDPLKIAKEYVESDIQAISVLTERNFFKGDEDYLVKIRQFCPLPILRKDF
IIDLWQIYESRYIGADAILLIVSLLSDEELKKFQIVANILGMQCLVEVHDERELERALES
GARIIGINNRDLRTFEVDLKNTEKLMNRIPNDRVVVSESGIKDTEDLKYLKELGVDAVLI
GETFMRARSISEKIREFKAV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaaattgtagcgcaaaaaaaaatacagcttaaaaaagatatgagcagg
attaccatagaaggctggaagcaaaaaattaaaagaccgggaatccacaaacctctggac
ttttacggagctttaaagaacaatggggatatatccattattgccgaggtaaagaaggct
tcaccgtcaaaagggattataaaggaggactttgatccgctcaaaattgcaaaagaatac
gttgagtcggatattcaggctatatcggtgcttacggaaaggaactttttcaagggggat
gaagactaccttgtaaagattcgtcagttctgtcctcttcctattttgagaaaggatttt
ataatcgatttgtggcagatatatgagtcgcggtatattggggccgatgcaatattgctt
attgtatcactgctttccgatgaggaactgaaaaaattccagatcgttgcaaatatttta
gggatgcagtgcctggttgaggtgcatgatgaaagggaacttgagcgggctttggaatcc
ggcgcaagaataatcggaataaacaacagggatcttagaacttttgaagtggatttaaag
aatactgaaaagcttatgaacaggatacccaatgaccgggtggtggtaagcgaaagtgga
attaaggacaccgaagatttaaagtatctgaaagagcttggcgtggatgctgttttaatt
ggcgagacctttatgcgggcccggtccataagtgaaaaaataagagagtttaaagcggtg
tga

DBGET integrated database retrieval system