KEGG   Hungateiclostridium thermocellum DSM 1313: Clo1313_1523Help
Entry
Clo1313_1523      CDS       T01933                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
ctx  Hungateiclostridium thermocellum DSM 1313
Pathway
ctx00620  Pyruvate metabolism
ctx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Clo1313_1523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctx02000]
    Clo1313_1523
Enzymes [BR:ctx01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Clo1313_1523
Transporters [BR:ctx02000]
 Other transporters
  Primary active transporters [TC:3]
   Clo1313_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ADU74585
Position
complement(1780291..1781688)
Genome map
AA seq 465 aa AA seqDB search
MAKVKITETALRDAHQSLIATRMRIEEMLPIIDKLDEIGYHSLEVWGGATFDACLRFLNE
DPWERLRIIKSHCKKTPLQMLLRGQNLLGYKHYADDVVEYFVQKSVANGINIIRIFDALN
DTRNIETAIKACKKEGGHAQGTVCYTISPVHNLELFVKDAKTLVEMGADSICVKDMAGLL
LPYVAYDLIKALKENVKVPIQLHTHYTSGVASMTYLKAIEAGCDVVDCAISPMSMGTSQP
PTEPLVATLKGTPYDTGLDLDKLSEIADYFRPLKEKYISEGLLDVKVMGVDVNTLKYQVP
GGMLSNLVSQLKQSNAVDKFEEVLKEVPRVREDFGYPPLVTPTSQIVGTQAVLNVVTGER
YKMVPKESKALIKGEYGRTPAPVNPEVQKKILKDEEPITVRPADLIEPELDKIRNEMKEY
LEQDEDVLSYALFPQVAEKFFQYRKAQKYKIEPDMVDYENRVHPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtaaaaattaccgaaacggcgctgagggatgcccatcaatctctcattgca
acaagaatgagaatagaagagatgcttcctatcatagataaactggacgagatcggttat
cattctttggaggtatggggcggtgcaacctttgatgcctgcctgagatttttgaatgaa
gacccgtgggaaaggcttagaattataaaaagccactgcaagaaaactccccttcaaatg
cttttaagaggccagaatcttttgggttacaagcattatgccgatgacgttgtggagtac
tttgtacaaaagagcgttgcaaacggtataaacataataagaattttcgacgccttgaat
gacaccagaaatatagaaactgcaatcaaagcctgcaaaaaagaaggcggtcatgctcag
ggaacggtatgttatacaataagtcccgttcacaatcttgaactttttgtcaaagatgca
aagactcttgtggaaatgggagctgactccatatgcgtaaaggatatggcaggacttctg
cttccatatgttgcatatgaccttatcaaagcattaaaagaaaacgtaaaagtgccgatt
caacttcatacccactatacgagcggtgttgcttcaatgacatatctgaaggcaattgag
gcagggtgcgatgttgtggactgcgctatctcaccaatgtcaatgggaacatcccagcct
ccgacagaacctcttgtggcaaccttaaaaggcacgccgtacgataccggacttgacctg
gataaattaagtgaaatcgcagactacttcagacctctcaaagaaaagtatatttcagaa
ggacttcttgatgtaaaggttatgggagttgacgtaaacactctcaaataccaggtaccc
ggtggaatgctttcaaacctggtgtctcagttaaagcagtccaatgcggttgataaattc
gaagaggttctgaaagaagtgccaagagtaagagaagacttcggatatcctccgttggtt
acacctacaagccagattgtaggtactcaggcagttttaaatgtggtaacgggtgaaaga
tacaaaatggttccaaaagaatccaaggcactgatcaagggtgaatacggcagaacaccg
gctccggtcaaccctgaagttcagaagaagattttaaaagatgaagagccgattacagtt
agacctgctgatttgatagagcccgagcttgacaagatcagaaatgaaatgaaagaatac
ctggaacaagacgaggacgttttgtcctatgcactgttcccgcaggtggcagagaagttc
ttccaatacaggaaagctcaaaaatataagatagaaccggacatggtcgattacgaaaac
agggttcatccggtttaa

DBGET integrated database retrieval system