KEGG   Ruminiclostridium thermocellum DSM 1313: Clo1313_2847Help
Entry
Clo1313_2847      CDS       T01933                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ctx  Ruminiclostridium thermocellum DSM 1313
Pathway
ctx00040  Pentose and glucuronate interconversions
ctx00052  Galactose metabolism
ctx00500  Starch and sucrose metabolism
ctx00520  Amino sugar and nucleotide sugar metabolism
ctx01100  Metabolic pathways
ctx01130  Biosynthesis of antibiotics
Module
ctx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Clo1313_2847
   00052 Galactose metabolism
    Clo1313_2847
   00500 Starch and sucrose metabolism
    Clo1313_2847
   00520 Amino sugar and nucleotide sugar metabolism
    Clo1313_2847
Enzymes [BR:ctx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Clo1313_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ADU75827
Position
complement(3343572..3344441)
Genome map
AA seq 289 aa AA seqDB search
MRVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIKSGIEDIIIISGRSK
RAIEDHFDKSYELEQELKKKGNHDLLKLVQDISNLANIHYIRQKEAKGLGHAIYCAKSFI
GNEPFAVLLGDDIVDSEVPCIKQLMDVYDKYRTTVLGVQKVPEDQVSKYGIVGGEIVSDR
VYKVKDLVEKPDTASAPSNIAILGRYIITPRIFDYLENAKPGKGGEIQLTDALRELMGEE
EMYAYDFIGKRYDVGNKLGFLQATVEFALARDDLKEEFEAYLKEIICKL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgagagtcagaaaagcaataattcctgcagcaggtctgggaaccagatttctacccgcc
acaaaagcgcagcccaaagaaatgcttcctattgttgacaagcctacaattcaatatatt
gttgaagaagccataaagtcaggtatagaagatattataattatttcgggaagaagcaaa
agagcgatagaagaccactttgacaaatcatatgagctggagcaggagcttaaaaaaaaa
ggaaaccatgaccttcttaagctggttcaagatatatcaaacttggcaaacatacattac
atacgacaaaaagaagcaaaaggtctgggacatgccatatattgtgcaaagtcctttatt
ggcaacgagccttttgcagtgctgttaggcgatgatattgtggattcagaggtgccttgc
atcaaacaattgatggatgtgtatgataagtacagaacaacggttttgggagtacagaaa
gttcccgaagatcaagtatccaagtatggtatagtgggcggggagattgtgagtgacagg
gtgtacaaggtgaaagatcttgtggagaagcctgacacagccagtgcaccgtccaatata
gccatcctgggaagatatattattactccaaggattttcgattatcttgagaatgcaaaa
cccggcaagggaggagagattcagctgacagacgcattaagagagctgatgggagaggaa
gaaatgtacgcttatgattttatcggaaagcgttacgatgtgggaaacaaacttggattc
ttacaagcaacggtggagtttgctctggcaagagatgacttgaaagaagaattcgaggca
tatttgaaagagattatctgtaaactgtaa

DBGET integrated database retrieval system