KEGG   Clostridium tyrobutyricum: CTK_C01450Help
Entry
CTK_C01450        CDS       T04331                                 

Gene name
thl
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ctyk  Clostridium tyrobutyricum
Pathway
ctyk00071  Fatty acid degradation
ctyk00280  Valine, leucine and isoleucine degradation
ctyk00310  Lysine degradation
ctyk00362  Benzoate degradation
ctyk00620  Pyruvate metabolism
ctyk00630  Glyoxylate and dicarboxylate metabolism
ctyk00640  Propanoate metabolism
ctyk00650  Butanoate metabolism
ctyk00900  Terpenoid backbone biosynthesis
ctyk01100  Metabolic pathways
ctyk01110  Biosynthesis of secondary metabolites
ctyk01120  Microbial metabolism in diverse environments
ctyk01130  Biosynthesis of antibiotics
ctyk01200  Carbon metabolism
ctyk01212  Fatty acid metabolism
ctyk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctyk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTK_C01450 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    CTK_C01450 (thl)
   00640 Propanoate metabolism
    CTK_C01450 (thl)
   00650 Butanoate metabolism
    CTK_C01450 (thl)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CTK_C01450 (thl)
   00072 Synthesis and degradation of ketone bodies
    CTK_C01450 (thl)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CTK_C01450 (thl)
   00310 Lysine degradation
    CTK_C01450 (thl)
   00380 Tryptophan metabolism
    CTK_C01450 (thl)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTK_C01450 (thl)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CTK_C01450 (thl)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CTK_C01450 (thl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctyk04147]
    CTK_C01450 (thl)
Enzymes [BR:ctyk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CTK_C01450 (thl)
Exosome [BR:ctyk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTK_C01450 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AND83415
UniProt: E3VJQ0
Position
162762..163943
Genome map
AA seq 393 aa AA seqDB search
MSEVVIASAVRTAIGKFGGSLKSVPATDLGALVIKEALKRANVKPELVDEVVMGNVLQAG
LGQNPARQALIKSGIPNTVPGFTINKVCGSGLRAVSLAAQMIKAGDDDIVVAGGMENMSA
APYVMPSARWGQRMFDGKIIDEMVKDGLWDAFNNYHMGITAENIAEKWNITRQMQDEFAA
ASQQKAVAAIKSGKFKDEIVPVVIKDRKKGEIVFDTDEFPRDGVTVEGISKLKPAFKKDG
GTVTAANASGINDAAAALVIMSADKAKELGIKPLAKITSYGSKGLDPSIMGYGPFHATKL
ALKKANLTVDDLDLIEANEAFAAQSLAVAKDLKFDMSKVNVNGGAIALGHPIGASGARIL
TTLLYEMQKRDSKRGLATLCIGGGMGTAIIVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagttgtaattgcaagtgccgttagaacagcaataggtaaatttggaggtagc
ttgaagtcagttccagcaactgatttaggagctttggttataaaagaagcattaaaaaga
gctaatgttaaaccagaacttgtagatgaagttgtaatgggtaatgtattacaggcaggt
ttaggtcagaatccagcaagacaagcattgataaaatcaggtatacctaatacagtccct
ggatttactataaataaagtttgtggttcaggacttagagcagtaagtttagcagctcaa
atgataaaagctggcgatgatgatatcgttgtagctggtggaatggaaaatatgtctgct
gctccatatgtaatgcctagtgcaagatggggacaaagaatgtttgatggtaagattata
gatgaaatggtaaaagacggactttgggatgcttttaataactatcacatgggtattacg
gctgaaaatatagcagaaaagtggaacataacaagacaaatgcaggatgaatttgcagct
gcatcacaacaaaaagcagtagcagctataaaatctggcaagtttaaagatgaaatagtt
ccagtagtaatcaaggatagaaaaaagggagaaatagtatttgatactgatgaattccct
agagatggtgtaactgtcgaaggaatatcaaaattaaaaccagcatttaagaaggatggt
ggaactgttacagctgccaatgcttcaggtataaatgatgcagctgcagcattagttata
atgagtgcagacaaagcaaaagaattgggaattaaaccacttgctaaaattacttcttat
ggatcaaaaggcttggatcctagcataatgggatatggaccattccatgctacaaaacta
gcacttaaaaaagctaatttaactgtagatgatttagatttaatagaagcaaacgaagca
tttgctgctcagagtttagctgttgcaaaagacttgaaatttgatatgagcaaagtaaat
gtaaatggaggagcaatagcacttggacatcctattggagcttcaggcgcaagaatactt
actactttgctttatgaaatgcagaaaagagattcaaaacgtggtttagctacattatgt
ataggcggtggaatgggaactgctataatcgttgaaagataa

DBGET integrated database retrieval system