KEGG   Chlamydia trachomatis B/TZ1A828/OT: CTB_6971Help
Entry
CTB_6971          CDS       T01327                                 

Definition
(GenBank) low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctz  Chlamydia trachomatis B/TZ1A828/OT
Brite
KEGG Orthology (KO) [BR:ctz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CTB_6971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CAX10258
Position
796091..797371
Genome map
AA seq 426 aa AA seqDB search
MWLLLVCVVVGGFYTAWNIGANDVANAVGPSVGAGALTLKQAVLIAAVFEFLGAVLLGDR
VIGTIESGLVAPSGHVLSSQDYVFGMTAALLATGVWLQIASFCGWPVSTTHAIVGAVLGF
GIILKEDAVIYWNSCGRVFVSWLASPIIGGYFAFLIFSFIRKAILYKKDPVSAMVRIAPF
LSAIIIFALGLVLILSGAVAPVISFSPALRIVCGLSLFAFFFTIWGIRFFKLAILPQEVL
PGTLLDRLLSKSTDYGRKYLIVERIFAYLQMIIACFMSFAHGSNDVANAVAPVAGIYRTL
YPQSYSSKVLLVFMSLGGLGLVCGLATWGWRVIDTIGKKITELTPSRGFSVGMSSAITIA
AASSLGFPISTTHVVVGSVLGIGFARGLRAINLRIIKDIVLSWFITVPAGAALSIVFFLL
LRALFC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgctgctggtttgtgtagttgtaggcggattctacacagcttggaacataggc
gctaatgatgtagcgaatgctgtgggaccaagtgtaggagccggtgcgctaactctaaag
caagccgttcttattgcagccgtctttgaatttcttggagcagtattgttaggagatcga
gttatcggcaccatagaaagtgggctggtagctccttccggtcatgtgttgtcatcccaa
gactatgtctttgggatgactgcagcgcttcttgccactggcgtgtggttgcagatcgct
tctttctgtggatggccagtgtcgacaacgcatgctattgtaggcgcagtgttgggcttc
ggtatcatccttaaagaggatgcggttatctactggaattcttgtggccgagtgtttgtc
agctggttagcatctcccattattggaggatactttgctttcctcatcttctcttttatt
cggaaagctatcctatataaaaaggatcccgtctctgctatggtgcgtatcgcgccattt
ttatcggcgatcattatttttgcattaggactagtccttatcctgagtggtgcagttgct
cccgttatttccttttctccagcgttgcgtattgtttgcggtttatctctttttgctttt
ttcttcacgatatggggaatacgcttctttaaacttgcgattcttcctcaggaagttctt
cctggaacattattagatcggttgttatccaaaagcaccgattatgggcgtaagtatctt
atagttgaacgcatttttgcttacttacagatgatcattgcatgctttatgtcttttgcg
catggatccaatgatgttgctaatgcggtcgctcctgttgcaggtatttaccggacactc
tatccccaaagttattcttcaaaagttctcttagtgtttatgtctttgggaggactaggt
ttagtttgcggattagcaacatggggctggcgtgtgattgatactatcgggaaaaaaatt
acagaattgactccatcacgaggcttttccgtaggaatgagttccgctatcactatagcg
gccgcttcctccttaggattccctatatctactacgcatgttgttgtaggatcggtattg
gggattgggttcgcaagaggtttacgagccattaatttgcggatcattaaagatattgtg
ctttcgtggtttattacagttcctgctggagcggcgctttctatcgtattttttttgtta
ctgcgcgcactattttgttaa

DBGET integrated database retrieval system