KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1116Help
Entry
CU7111_1116       CDS       T02457                                 

Gene name
fadA3
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua00071  Fatty acid degradation
cua00280  Valine, leucine and isoleucine degradation
cua00310  Lysine degradation
cua00362  Benzoate degradation
cua00380  Tryptophan metabolism
cua00620  Pyruvate metabolism
cua00630  Glyoxylate and dicarboxylate metabolism
cua00640  Propanoate metabolism
cua00650  Butanoate metabolism
cua00900  Terpenoid backbone biosynthesis
cua01100  Metabolic pathways
cua01110  Biosynthesis of secondary metabolites
cua01120  Microbial metabolism in diverse environments
cua01130  Biosynthesis of antibiotics
cua01200  Carbon metabolism
cua01212  Fatty acid metabolism
cua02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cua00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CU7111_1116 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    CU7111_1116 (fadA3)
   00640 Propanoate metabolism
    CU7111_1116 (fadA3)
   00650 Butanoate metabolism
    CU7111_1116 (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CU7111_1116 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    CU7111_1116 (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CU7111_1116 (fadA3)
   00310 Lysine degradation
    CU7111_1116 (fadA3)
   00380 Tryptophan metabolism
    CU7111_1116 (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CU7111_1116 (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CU7111_1116 (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CU7111_1116 (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cua04147]
    CU7111_1116 (fadA3)
Enzymes [BR:cua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CU7111_1116 (fadA3)
Exosome [BR:cua04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CU7111_1116 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AGE36708
Position
complement(1328360..1329676)
Genome map
AA seq 438 aa AA seqDB search
MTNGNQKKVAILGGNRIPFARSNKEYADASNQDMLTAAIEGLVARYGLQDEELGLVTGGA
VLKHSRDFNMVREVVLGSSLSNTTPAMDMQMACGTGLAAIVAVGDAIRAGRIESGIGSGV
DTTSDAPLAVGDQLRKTLIKLTQAKTTQQRLKLVGSIRPAQLAPDQPSNGEPRTGLSMGD
HAAITAREMNITREEQDEFAATSHQNLAKAYDEGFFEDLITPYLGVQRDTNLRPDSTPEK
LAKLKPVFGKRDAAQHGTTATMTAGNSTPLTDGASAVLLSSEEWAKERNLPVRAYLVDSE
VASVDFLHGHDGKTPDGLLMSPTYAVPRMLERNGLTLQDFDFYEIHEAFASQTLATLKAW
ESEEYCRERLGLDKPLGAIDRSKLNVKGSSLAAGHPFAATGGRIIATTAKLLEENGGGRA
LVSICAAGGQGIVAIVER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacggtaaccagaagaaggtcgccatcctcggcggcaaccgcattcctttcgcc
cgctccaacaaggagtacgcggacgcatccaaccaggacatgctcaccgcggccatcgag
ggcctcgtcgcccgctacggcctccaggacgaagagctcggcctggtcactggcggtgcg
gtcctgaagcactcccgcgacttcaacatggttcgcgaggtcgtgctgggctcctccctg
tccaacaccaccccggccatggacatgcagatggcctgtggcaccggcctggccgccatc
gtcgccgtcggcgatgccatccgcgcgggccgaatcgagtccggcatcggctccggcgtg
gacaccacctccgacgccccgctggcggtcggcgaccagctgcgcaagactctcatcaag
ctgactcaggccaagaccacccagcagcgcctgaagctggtcggctccatccgcccggcc
cagctggcaccggatcagccgagcaacggcgagccgcgcaccggcctgtccatgggtgac
cacgctgcgatcaccgcccgtgagatgaacatcacccgcgaggagcaggacgagttcgcc
gcgacctcccaccagaacctcgcgaaggcttatgacgagggcttcttcgaggacctcatc
accccgtacctcggcgtgcagcgtgacaccaacctgcgcccggactccaccccggagaag
ctggccaagctcaagccggtcttcggcaagcgcgacgccgcgcagcacggcaccaccgcc
accatgaccgccggtaactccaccccgctgaccgacggggcatccgccgtcctgctctcc
tccgaggagtgggccaaggagcgcaacctcccggtccgtgcctacctggtggactccgag
gtcgcttccgtggacttcctgcacggccacgacggcaagaccccggacggcctgctgatg
agcccgacctacgccgtcccgcgcatgctggagcgcaacggcctgaccctccaggacttc
gacttctacgagatccacgaggccttcgcctcccagaccctggccaccctgaaggcctgg
gaatccgaggagtactgccgcgagcgcctgggcctggacaagccgctgggtgcgatcgac
cgctccaagctcaacgtcaagggctcctcgctggccgctggccacccattcgccgcaacc
ggtggccgcatcatcgccaccaccgcgaagctgctcgaggagaacggcggcggccgcgca
ctggtctccatctgtgcagcaggtggccagggcatcgtcgccatcgtcgagcgctaa

DBGET integrated database retrieval system