KEGG   Corynebacterium urealyticum DSM 7111: CU7111_1266Help
Entry
CU7111_1266       CDS       T02457                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cua  Corynebacterium urealyticum DSM 7111
Pathway
cua00260  Glycine, serine and threonine metabolism
cua00750  Vitamin B6 metabolism
cua01100  Metabolic pathways
cua01110  Biosynthesis of secondary metabolites
cua01120  Microbial metabolism in diverse environments
cua01230  Biosynthesis of amino acids
Module
cua_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cua00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CU7111_1266 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CU7111_1266 (thrC)
Enzymes [BR:cua01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CU7111_1266 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AGE36856
Position
complement(1502325..1503776)
Genome map
AA seq 483 aa AA seqDB search
MDYISTRDSSRTPAKFSDILLGGLAPDGGLYLPAEYPQLSDETLTEWRELLAEKGYAALA
AEVLKIFVDDIPAEDLEAITARAYTTKAFAHEEIVPVTELEDGMYLGHLSEGPTAAFKDM
AMQLLGELFEYELARRGETLNILGATSGDTGSAAEYAMRGRQGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNIFNIALDGVFDDCQDVVKAVSADADFKRDNRIGAVNSINWARLMAQVVYY
ISSWLKLTESNDQKISFSVPTGNFGDICAGHIAKQMGLPIERLIVATNENDVLDEFFRTG
EYRVRSSAETLKTSSPSMDISRASNFERFVFDLLGRDADRVADLFGVKVREGGFSLADDP
AFPEAAATYGFASGTSSHADRVATIRDLHERLGVIIDPHTADGVKAAQQWRDQVEGPIVV
LETALPVKFAETIEEAIGEVPEVPERFAGIMDADRHVVDLPNDAERVKQYILDSIAETKE
VEN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtggactacatttcgactcgtgattcttcccgtacccccgccaagttctcggacatcctg
ctgggcggcctggccccggacggcggcctctacctgcccgccgagtacccgcagctgagc
gacgagaccctcaccgagtggcgcgagctgctcgcggagaagggctatgccgcgctggct
gccgaggtgctgaagatttttgtggatgacatcccggccgaggacctggaggccatcacg
gcccgggcgtatacgacgaaggctttcgcgcacgaggagatcgtccccgtcacggagctc
gaggacggcatgtacctgggccacctctctgaggggccgacggctgcttttaaggacatg
gccatgcagctgctcggcgagttgtttgagtacgagctagcccgccgcggcgagaccctg
aacatcctgggcgcgaccagcggtgacacgggttcagcggcggagtacgccatgcgtggc
cgccaggggatccgcgtgttcatgctgaccccggccgggcgcatgacgcccttccagcag
gcgcagatgttcggcctggatgatccgaatatcttcaacatcgccctggacggggtcttc
gatgactgccaggacgtggtcaaggccgtgtccgcggatgcggatttcaagcgggataac
cgcatcggtgcggtgaactccatcaactgggcgcgcctgatggcccaggtcgtgtactac
atctcctcctggctgaagctgacggagtcgaatgaccagaagatcagcttctccgtgccg
accggcaatttcggcgacatctgcgcaggccacatcgccaagcagatgggcctgccgatc
gagcggttgatcgtcgcgacgaatgaaaacgacgtgctggatgagttcttccgcaccggc
gagtaccgggtgcgcagctccgcggagacgctgaagacctccagcccttcgatggatatt
tcccgtgcctcgaacttcgagcgtttcgttttcgacctgctgggtcgggacgccgatcgg
gtggcggacctgttcggtgtgaaggtgcgcgagggcgggttctccctggccgacgatccg
gcgttcccggaggcagcggcgacgtacggtttcgcgtccggtacctcttcgcatgcggat
cgcgtggcgacgattcgggatctgcacgagcgcctgggcgtgatcatcgacccgcacacc
gccgatggtgtgaaggccgcgcagcagtggcgtgaccaggttgagggcccgatcgtggtc
ctggagacggcgctgccggtgaagttcgcggagaccatcgaggaggccatcggggaggtc
cctgaggttccggagcgtttcgccgggatcatggacgccgaccgccacgtggttgacctg
ccgaacgacgctgagcgcgtgaagcagtacatcctggactccatcgcggagaccaaggaa
gtcgagaactag

DBGET integrated database retrieval system