KEGG   Curtobacterium sp. BH-2-1-1: BJK06_12060Help
Entry
BJK06_12060       CDS       T04562                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cub  Curtobacterium sp. BH-2-1-1
Pathway
cub00450  Selenocompound metabolism
cub00970  Aminoacyl-tRNA biosynthesis
cub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cub00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJK06_12060
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJK06_12060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cub01007]
    BJK06_12060
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cub03016]
    BJK06_12060
Enzymes [BR:cub01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJK06_12060
Amino acid related enzymes [BR:cub01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJK06_12060
Transfer RNA biogenesis [BR:cub03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJK06_12060
 Prokaryotic type
   Other AARSs
    BJK06_12060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AOX66387
Position
2520562..2522139
Genome map
AA seq 525 aa AA seqDB search
MSDGSSFSITTPIFYVNDVPHIGHAYTEVAADVLARWHRQRGDDTWLLTGTDEHGQKILR
TASANDVTPKEWADRLVTEAWKPLLDTVDVANDDFIRTTDERHERGVTAFLQKLYDDGYI
YAGEFEGFYCVGCEEYKQPSDLVPGTGAYEGQQVCAIHSIPVEVLSERNYFFRMSDFEQR
LLDLYESNPLFIQPESVRNEIISFVKQGLRDLSISRSSFDWGIQIPWDHDHVLYVWFDAL
LNYVTALGYGTDDDEAFQRLWPSVHIVGKDIARFHAVIWPAMLMAAGLPLPERVFGHGWL
LVGGEKMSKSKLTGIAPSEITDTFGSDAFRYYFLRAITFGQDGNFSWEDISARYQAELAN
GFGNLASRLVAMLQKYFDGAVPERGSLTSSDEAIDALAVSVTERADAAIAAFAPHEAIAA
VWELVDALNGYITEQQPWALAKVDAQRERLGTVLATALRGLGTVAVLLSPVMPKATEKLW
ASIGAGGSIAEQRVDRAWEWQGASTVVPLESGLFPRIEQSEQGAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgggtcctcgttcagcatcaccacgccgatcttctacgtgaacgacgtgccc
cacatcgggcacgcctacaccgaggtggccgcggacgtcctcgcgcgctggcaccggcag
cgcggcgacgacacgtggctgctcaccggcaccgacgaacacgggcagaagatcctgcgg
acggcctcggccaacgacgtcacgcccaaggaatgggccgaccggctcgtgaccgaggcg
tggaagccgctcctcgacaccgtcgacgtggcgaacgacgacttcatccgcaccacggac
gagcgccacgagcgcggtgtgacggcgttcctgcagaagctgtacgacgacggctacatc
tacgcgggcgagttcgagggcttctactgcgtgggctgcgaggagtacaagcagccgagc
gacctcgtccccggcaccggtgcgtacgaggggcagcaggtctgcgcgatccactcgatc
ccggtcgaggtgctgtccgagcgcaactacttcttccgcatgtccgacttcgagcagcgc
ctgctcgacctgtacgagtcgaacccgctgttcatccagccggagagcgtccgcaacgag
atcatctcgttcgtcaagcagggtctgcgcgacctgtcgatctcgcggtcgagcttcgac
tggggcatccagatcccgtgggaccacgaccacgtcctctacgtgtggttcgacgccctg
ctcaactacgtcacggcgctcgggtacggcaccgacgacgacgaggccttccagcgcctc
tggccgagcgtgcacatcgtcggcaaggacatcgcacggttccacgcggtgatctggccg
gcgatgctcatggccgccgggctgcccctccccgagcgcgtgttcggccacggctggctg
ctcgtcggcggcgagaagatgtcgaagtcgaagctgaccggcatcgcgccgtcggagatc
accgacacgttcgggtccgacgccttccgctactacttcctccgcgccatcaccttcggg
caggacggcaacttcagctgggaggacatctccgcccgctaccaggccgagctcgcgaac
ggcttcggcaacctcgcctcccgcctcgtcgcgatgctgcagaagtacttcgacggtgcg
gtgcccgagcgtgggtcgctgacctcgtccgacgaagcgatcgacgcgctcgcggtctcc
gtcaccgagcgcgccgacgccgccatcgccgcgttcgccccgcacgaggccatcgccgcg
gtgtgggagctcgtcgacgcgctgaacgggtacatcaccgagcagcagccgtgggcgctg
gcgaaggtcgacgcgcaacgcgagcggctcggcaccgtcctggccaccgcgctccgtggg
ctcggcaccgtcgccgtcctgctctcgccggtcatgccgaaggcgaccgagaagctctgg
gcctcgatcggtgccggcggatcgatcgccgagcagcgggtggaccgtgcctgggagtgg
cagggtgcctcgaccgtggtcccgctcgagtccgggttgttcccgcgcatcgagcagtcg
gagcagggcgcagcgtga

DBGET integrated database retrieval system