KEGG   Corynebacterium ulcerans 809: CULC809_00400Help
Entry
CULC809_00400     CDS       T01880                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cuc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CULC809_00400 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cuc03011]
    CULC809_00400 (rplV)
Ribosome [BR:cuc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CULC809_00400 (rplV)
  Bacteria
    CULC809_00400 (rplV)
  Archaea
    CULC809_00400 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEG80940
Position
441211..441573
Genome map
AA seq 120 aa AA seqDB search
MSESVTSARATARFVRVSPMKARRVIDLVRGKSIEEALAILKYAPQAASEPVAKVVASAA
ANAENNFGLDRRSLVISEAFADEGPTMRRFSPRAQGRAFQIRKRTSHITVVVESQKEGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatctgtcacctccgcacgcgctaccgcgcgcttcgtccgtgtctctcctatg
aaggcacgtcgcgtgatcgatctggtccgcggcaagtccatcgaggaagcactcgcaatc
ctgaagtacgctccgcaggctgcttctgagccggttgcaaaggtcgttgcttctgcagcc
gctaacgctgagaacaacttcggtctagatcgccgctccctggtcatctctgaggctttt
gctgacgagggtccgaccatgcgtcgtttcagcccccgcgctcagggtcgtgctttccag
atccgcaagcgcaccagccacatcaccgtggttgttgagagccagaaggaaggggccaag
tag

DBGET integrated database retrieval system