KEGG   Corynebacterium ulcerans 809: CULC809_01202Help
Entry
CULC809_01202     CDS       T01880                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00030  Pentose phosphate pathway
cuc00480  Glutathione metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01200  Carbon metabolism
Module
cuc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cuc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CULC809_01202 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CULC809_01202 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cuc04147]
    CULC809_01202 (zwf)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CULC809_01202 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CULC809_01202 (zwf)
Exosome [BR:cuc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CULC809_01202 (zwf)
  Exosomal proteins of colorectal cancer cells
   CULC809_01202 (zwf)
  Exosomal proteins of bladder cancer cells
   CULC809_01202 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N V_cholerae_RfbT
Motif
Other DBs
NCBI-ProteinID: AEG81735
Position
1338356..1339882
Genome map
AA seq 508 aa AA seqDB search
MNPWVNPLRDSEDKRLPRIAGPSGMVIFGVTGDLARKKLLPAIYDLANRGLLPAGFALVG
YGRREWSKQDFEDYVHEAVKAGARTEFRENVWSRLAEGIHFARGNFDDDQAFDDLAALLS
RLDKEQGTAGNWAYYLSVPPDYFSDVCHQLQRSGMAQAEGNSWRRVIVEKPFGHDQESAR
ELNTLINSVFPEKSVFRIDHYLGKETVQNILALRFANQLFDPLWNSHYVDHVQITMAEDI
GLGGRAGYYDGIGAARDVIQNHLIQLLALVAMEEPIDFTPQQLQAEKIKVLRATRPVGPF
AKTTARGQYASGWQGSELVKGLREEDGFDPQSTTETYAACTLEINSRRWAGVPFYLRTGK
RLGRRVTEIALVFKDAPHQPFSEGTRHSQGQNVVVIRVQPDEGMLMRFGSKVPGSAMEVR
DVNMDFSYSEAFTEESPEAYERLILDALLDEASLFPTNEEVELSWNILDPILNFWAERGQ
PEEYAAGTWGPASADRMLERVDRAWRRP
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccttgggttaacccgcttcgtgattctgaggacaaacgtcttccgcggattgcc
gggccaagcggcatggttattttcggagtaaccggagatttggcgcggaaaaaactcctt
cccgcgatttatgatcttgccaaccgtggcctgctacctgcgggttttgccctggtaggc
tatggccgtcgggagtggtctaaacaagattttgaagattacgtacacgaggcagtaaaa
gctggtgcacgtacggagtttcgtgaaaacgtctggtctagactagccgagggaattcat
tttgcccgcggaaactttgacgacgatcaagcctttgatgatcttgccgcactcttgagt
cgtttagacaaggaacaaggaaccgccggaaactgggcttactacctatccgtgccaccg
gattatttctccgatgtctgtcaccagctgcagcgctccggcatggctcaagctgagggc
aattcatggcgccgagtgatcgtggaaaaaccattcggacacgatcaagagtcagcacgc
gaactcaacaccctgattaactcagttttcccggaaaaatcggtcttccgtatcgatcac
tatctaggaaaagaaactgttcagaacattctggctctccgctttgcaaaccaactcttt
gacccattgtggaactcgcattatgtagaccatgtgcagattacgatggcagaagatatc
ggactaggtggccgtgctggctattacgatggtatcggagcagctcgcgacgttattcag
aatcacctgattcagcttctcgccctcgtggcaatggaagaacccattgatttcactcca
cagcaactgcaagcagagaaaatcaaggtcttacgcgcaacccgtcctgttggtcctttt
gccaagacgaccgcacgcggccaatacgccagcggatggcagggttcagagttggtcaag
ggcctgcgcgaggaagacggttttgatccgcaatcaaccacagagacctacgcagcgtgc
actttagaaatcaattctcgccgctgggctggagttccgttctatctgcgtaccggtaag
cgcctcggtcgacgcgtcactgagatcgctttggtcttcaaagatgctccccaccagcct
ttcagcgagggtacacgccattcccagggacaaaacgttgtggttattcgcgttcaaccg
gatgaaggcatgctgatgcgatttggttctaaagttccaggctcagcaatggaagtccgc
gatgtgaatatggatttctcctattccgaagcgttcaccgaagagtctcccgaggcttat
gagcgtctgatattagatgcgctcctggatgaggccagccttttccccacaaatgaagag
gttgaactcagctggaatattttggaccccattcttaatttttgggcagagcgcgggcag
ccagaggaatatgcggcaggaacatggggcccggcttcagcagaccgcatgctagagcgg
gtagatcgagcatggcgtcgaccttaa

DBGET integrated database retrieval system