KEGG   Corynebacterium ulcerans 809: CULC809_01780Help
Entry
CULC809_01780     CDS       T01880                                 

Gene name
cat
Definition
(GenBank) succinyl-CoA:Coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00020  Citrate cycle (TCA cycle)
cuc00620  Pyruvate metabolism
cuc00650  Butanoate metabolism
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC809_01780 (cat)
   00620 Pyruvate metabolism
    CULC809_01780 (cat)
   00650 Butanoate metabolism
    CULC809_01780 (cat)
Enzymes [BR:cuc01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CULC809_01780 (cat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AEG82307
Position
complement(2006618..2008123)
Genome map
AA seq 501 aa AA seqDB search
MSDRIANAQLRGKIMSAQEAAQFVDNGDKVGVSGFTGAGYPKVMPAAIAERAKEARAKGE
SYTIDLFTGASTAPDCDGVLAEAGALRFRMPYQSDPSMRKAINSGDMLYSDIHLSHSGAM
VAEGFFGQLNVAIVEAVRIKEDGSIVPSSSVGNSVEYLDAAEKIIIEVNSWQSEHLEGMH
DIWRMPRTPNRIPIPIKNTGDRIGDTSISIDPNKVVAVIETDAPDRNAPFKPLDDVSREI
ASNFLGFLEGEVKAGRLDYDRYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYADKMNENAEFYRKHIILRPQQISNHPEVIRRTGLIASNG
MIEADIYGNVNSTHVNGVRMMNGIGGSGDFTRNALISTFISPSVAKDGAISAIVPFASHT
DHTEHDVMVIITEYGVADLRGLAPRERVQKTISVAHPDYRPLLEEYFEAAKKATPFMQTP
HDLTQAFSFHQRMNETGTMAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgctaacgcacagttgcggggcaaaattatgtcggcacaagaggcc
gctcagttcgtagacaacggcgataaagtcggtgtctcgggctttaccggtgctggctac
ccaaaggttatgcctgctgcaatcgctgaacgggcaaaggaagcgcgggctaaaggggaa
agctacactattgatctctttaccggagcttctaccgcaccagactgcgatggcgtacta
gcagaagccggagctttgcgtttccgaatgccatatcagtccgaccccagcatgcgtaaa
gctattaactcaggcgacatgctgtactccgatattcacctgtcgcattcaggcgcaatg
gtcgcggagggcttctttggccagctgaacgtggccatcgttgaggctgtccgcattaag
gaagatggatcgatcgtgccttcttcctccgtaggaaactctgtggaataccttgatgct
gcagaaaaaatcatcatcgaggttaactcctggcagtccgagcaccttgaaggaatgcac
gacatttggagaatgccgcgtaccccgaaccgcattcctatcccgatcaagaacaccggt
gaccgtatcggcgatacctcgatttctatcgaccccaataaggtagtcgcggttattgag
accgatgctcctgaccgcaacgctcctttcaagcctctcgacgacgtctctcgcgagatc
gcctcgaacttcttgggcttcctcgaaggcgaagtgaaagctggccgcctcgattatgac
cgctacatcatgcagtccggtgtgggtaacgttcccaatgccgtgatggcaggcctgttg
gactctaagtttgaaaacattcaggcttacaccgaggttatccaagatggcatggtcgac
ctgatcgacgccggcaagatgactgttgcctctgcgacctcattctcgctgtcgccggag
tacgcagacaagatgaacgagaatgcggagttctaccgcaagcacatcattcttcgccca
cagcagatctctaaccaccctgaggtgattcgccgcaccggactgatcgcatccaacggc
atgatcgaagctgacatttacggcaacgtgaattcaacgcacgtcaatggtgtgcgcatg
atgaacggtattggtggctccggtgacttcactcgtaacgctttgatctccacgttcatc
tctccatcggtggctaaggacggtgctatctccgctatcgttcctttcgcatctcacacc
gaccacacggagcacgacgtcatggtgattatcaccgagtatggtgtcgcagacttgcgt
ggacttgcgccacgcgagagagtccaaaagaccatttccgttgcgcatccggattatcgc
cccttgctggaggagtacttcgaggcagcaaagaaggcaacgcctttcatgcagacccct
catgaccttacccaggcattctcgttccaccagcgcatgaacgagaccggaaccatggct
aagtaa

DBGET integrated database retrieval system