KEGG   Corynebacterium ulcerans 809: CULC809_01971Help
Entry
CULC809_01971     CDS       T01880                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cuc  Corynebacterium ulcerans 809
Pathway
cuc00010  Glycolysis / Gluconeogenesis
cuc00071  Fatty acid degradation
cuc00350  Tyrosine metabolism
cuc00625  Chloroalkane and chloroalkene degradation
cuc00626  Naphthalene degradation
cuc01100  Metabolic pathways
cuc01110  Biosynthesis of secondary metabolites
cuc01120  Microbial metabolism in diverse environments
cuc01130  Biosynthesis of antibiotics
cuc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cuc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC809_01971 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    CULC809_01971 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CULC809_01971 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CULC809_01971 (adhA)
   00626 Naphthalene degradation
    CULC809_01971 (adhA)
Enzymes [BR:cuc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CULC809_01971 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11 TRAM
Motif
Other DBs
NCBI-ProteinID: AEG82498
Position
complement(2219302..2220339)
Genome map
AA seq 345 aa AA seqDB search
MKNDFPEAFTAAVVDDFGPELTIHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGA
HGVLVTAVHPQAFGQAIGMTRKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLDDVNSVFADMHQGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaa
ctcactattcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaacta
gtagcttccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaa
ccggaaccaccgtttgttcctgggcatgaaggcgtgggcgaagtcgttaaattagggcct
ggccatcacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgt
ggggagtgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggt
ggctacacggttgatggctccttcggtgaatacatgctggtagatacccgttactgtgct
cgcattccagagggatctgaccccatcgaggttgccccgatcttgtgtgctggtgtgact
gtatataagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggt
atcggcggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaatt
gcagtggatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgca
gtaaatgcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcg
catggcgttctggtcaccgctgttcacccgcaagcgttcggtcaagccattggtatgact
cgaaaaggtggaacgatcgtatttaatggtcttcctccaggagagttccctgcacctatc
tttgagattgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggat
ttggaagaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgc
aagcttgacgacgtcaacagtgtcttcgccgatatgcatcagggcaaagtcgatgggcgc
atggcgattaggtactaa

DBGET integrated database retrieval system