KEGG   Corynebacterium ulcerans 0102: CULC0102_1224Help
Entry
CULC0102_1224     CDS       T02171                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00670  One carbon pool by folate
cue01100  Metabolic pathways
cue01120  Microbial metabolism in diverse environments
cue01200  Carbon metabolism
Module
cue_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cue00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CULC0102_1224 (fhs)
Enzymes [BR:cue01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CULC0102_1224 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS DUF3563
Motif
Other DBs
NCBI-ProteinID: BAM27423
Position
complement(1310580..1312229)
Genome map
AA seq 549 aa AA seqDB search
MPSDVQIAQAHTLEPIVDIATRAGISTEALIPYGKTKAKVDITAEELQPDGKLVLVTGMS
PTPAGEGKSTVLIGLSDAMRLRGHNAIVAIREPSLGPVMGIKGGAAGGGYSQIVPMEDIN
LHFTGDFHAITSANNTLAAMIDNHIQQGNELGIDARRITWQRCLDVNDRSLRNVVTGLGG
KPHGTPTQTGFTITAASEIMAILCLSTDLSDLENRISRIVIGQNFDGKPITVKELNAQGA
MTALLRDAINPNLVQTLGGTPAFCHGGPFANIAHGCNSLIATKTALHYGDVVLTEAGFGS
DLGAEKFFDIKMRAGELSASAVVIVATIRSLKYNGGVAKDQLTSENLDALKQGIVNLERH
VENIRNFGVEPVVALNMFTSDTAAEQKYMEDWAAGFGVRLIPVQVWAKGGEGALELADAV
ADMLGQSSEPLYDPSQGLEASLETIATKVYGAKEVMLSKEAQRDLDYLKDNGWDTLPVCI
SKTQYSFSDDPAELGRPEGHILHVRSLLPRIGAGFILALTGDVMTMPGLPKRPAAEKITV
ENGNIHGLF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgccctcagacgtccagatcgcccaggctcacactctggagcccatcgttgacattgca
acgcgtgctggaatcagcacagaagctctcattccttacggcaaaacaaaagccaaagtt
gatatcactgcagaagaactccaaccagatggcaagctcgtgctagtaactggtatgtcc
ccaacccctgcaggagaaggtaaatccactgtcttgatcggcctctccgatgcgatgcgg
ttgcgcggacacaacgccattgttgctatccgggagccttccctcggcccagtcatgggg
atcaaaggtggtgctgctggaggtggatattctcagatcgtgcccatggaggacattaac
cttcattttacgggtgatttccacgcgattacgtccgcgaataacacccttgcagcaatg
atcgataatcatattcagcagggtaacgagctaggtatcgacgcacgacgtattacgtgg
cagcgctgcttggacgttaacgatcgctcgctgcgcaacgttgtcaccggtcttggtggg
aagcctcatggcacgcctacccagaccggttttacaattacggctgcaagcgaaatcatg
gcgattctatgcttgtccaccgatctatcggacttggaaaaccggatctctcgtatcgtg
atcgggcagaactttgacggtaaaccgatcactgtaaaagagctgaacgcacagggtgca
atgacggctttgttacgcgatgcaattaaccccaacctcgttcaaaccctcggtggaacc
cccgctttttgtcacggcggtccttttgccaatattgctcacggttgtaactctcttatc
gcaaccaagactgctttgcattatggtgatgtcgttcttacggaggccggttttgggtcc
gatcttggtgcagaaaagttctttgatatcaagatgcgtgcaggagagctctcggcttca
gcagtggttatcgttgcgactatccgatctttgaaatataacggtggcgttgccaaagac
cagctcacctcagagaaccttgacgctctcaagcagggaatagtcaaccttgagcggcac
gtagaaaacattagaaactttggcgtggagcctgttgtagcgctcaacatgtttacctct
gataccgccgcagagcagaagtatatggaagattgggcggctggctttggggtgcgattg
attccagtgcaggtctgggctaagggaggggaaggggctcttgagctcgccgatgcggtg
gccgacatgctggggcaatcttctgaaccgctctatgacccaagccaaggactggaggct
tctttagagactatcgctacaaaagtctatggtgctaaagaggtcatgctgagcaaagaa
gcacagcgagatcttgattatctcaaggacaacggctgggatacgcttcccgtgtgcatc
tcaaaaacccagtattcctttagcgatgatcccgcggagttaggtcgtcccgaaggccac
atcctgcatgtgagaagcttgctgcctcggattggtgctgggttcatcctggcactcact
ggtgacgtcatgacgatgccaggcttgcccaagcgtccagcagccgagaagatcaccgta
gaaaacggaaacatccacggcttgttctaa

DBGET integrated database retrieval system