KEGG   Corynebacterium ulcerans 0102: CULC0102_1653Help
Entry
CULC0102_1653     CDS       T02171                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cue  Corynebacterium ulcerans 0102
Pathway
cue00010  Glycolysis / Gluconeogenesis
cue00052  Galactose metabolism
cue00500  Starch and sucrose metabolism
cue00520  Amino sugar and nucleotide sugar metabolism
cue00521  Streptomycin biosynthesis
cue01100  Metabolic pathways
cue01110  Biosynthesis of secondary metabolites
cue01120  Microbial metabolism in diverse environments
cue01130  Biosynthesis of antibiotics
cue01200  Carbon metabolism
Module
cue_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cue00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC0102_1653 (glk)
   00052 Galactose metabolism
    CULC0102_1653 (glk)
   00500 Starch and sucrose metabolism
    CULC0102_1653 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC0102_1653 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CULC0102_1653 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CULC0102_1653 (glk)
Enzymes [BR:cue01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CULC0102_1653 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N TCR FGGY_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: BAM27852
Position
complement(1780784..1781737)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIELVDALRQKH
EISAVGLAVAGFLDPDCEVVRFAPHLPWRDRAVRAELSESLGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRVCSCGKRGCL
ERYCSGTALETTAREMIAAGKATDSVLIDALANGSLSGKRIMAAAGDGDQLACAVVEDFA
QWMGRALSIVADVLDPGLIVIGGGVSTASALYLDTAVETMSTSMVGAGYRPLPKVSCAEL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggaactaacatgcgg
gcggcggcggtgacttcggatgggcagattattgactctatgtcggttcctacgccatcg
actcctgaattgctcgaatccggaatcatcgagctggtagacgctctgaggcagaagcat
gagatttccgcagtagggttggcggtagctggttttttggatcctgattgtgaagttgtt
cgttttgctccgcatctcccgtggagagatcgagctgttcgcgcagagctttcagagtcc
ctaggattaccggttcgtctcgagcacgatgcaaattcggcagcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctctttgccgtaggaaccggaattggt
gccactcttatgcatcaaggagagatttatcgtggagcgtttggcacagcgccagaattt
ggtcatctcactgtagtcccagggggacgggtatgctcctgtggcaaacgcggatgtcta
gaacggtactgttcaggaacggctttggaaactactgctcgtgagatgattgcagcgggc
aaagcaaccgactccgtgcttatcgacgctctagctaacggttccttaagcggtaaacgc
attatggctgcagctggtgatggtgatcagcttgcttgcgccgttgtagaagatttcgcc
caatggatgggacgagctctgtccatagtggcagatgtccttgatcccggacttatcgtg
atcggtgggggagtatccactgcaagcgcactctacctcgatactgccgtggagacgatg
agtacatcgatggtgggggcagggtaccgcccccttcccaaagtttcgtgtgcggagcta
ggtggagatgcgggtatgatcggggtatctgatttggctcgccaattggtctga

DBGET integrated database retrieval system