KEGG   Curtobacterium sp. SGAir0471: C1N91_06305Help
Entry
C1N91_06305       CDS       T05978                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cug  Curtobacterium sp. SGAir0471
Brite
KEGG Orthology (KO) [BR:cug00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cug03009]
    C1N91_06305
Enzymes [BR:cug01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     C1N91_06305
Ribosome biogenesis [BR:cug03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    C1N91_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: QCR43216
UniProt: A0A4P8SRS1
Position
1376615..1377544
Genome map
AA seq 309 aa AA seqDB search
MSEQRSLPVPDGLAGERVDAAIAKLLGFSRSFAAEVVAAGGVRVDGVEVGKSDRLHADSW
LEVEWSPKEPPRIVPVEVPGMRIVHDDEDIVVVDKPIGVAAHPSPGWDGPTVPGGLAAAG
FTIATSGAAERAGIVHRLDVGTSGLMVVAKTELAYTHLKRAFKERTVDKVYHALAQGHPD
PTAGTIDAPIGRHPSSDWKFAVTADGKPSVTHYETLEAFRSASLLEVHLETGRTHQIRVH
MAATKHPLVGDTMYGADPVLASELGLTRQWLDAVRLGFEHPRTGEWVEFEASYPDDLQQA
LDRIRAASA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagcgttccctgcccgtgccggacggactcgccggcgagcgggtcgacgcg
gcgatcgcgaagctgctcgggttctcgcggtccttcgcggccgaggtcgtcgcggccggt
ggtgtccgggtcgacggcgtcgaggtcgggaagtccgaccgtctgcacgccgactcgtgg
ctcgaggtcgagtggtccccgaaggaacccccgcgcatcgtgccggtcgaggtccccggc
atgcggatcgtgcacgacgacgaggacatcgtcgtcgtcgacaagccgatcggcgtcgcc
gcgcacccctcgcccggctgggacgggccgaccgtccccggtgggctcgccgccgctggc
ttcacgatcgcgacctccggcgccgccgagcgcgcgggcatcgtgcaccggctcgacgtc
ggtacctcgggcctgatggtcgtcgcgaagaccgagctggcgtacacgcacctgaagcgg
gcgttcaaggagcgcacggtcgacaaggtctaccacgcactggcgcaggggcaccccgac
ccgactgcggggaccatcgacgcccccatcggtcggcacccgtcgagtgactggaagttc
gcggtcacggccgacggcaagccgagcgtgacgcactacgagaccctcgaggccttccgg
tcggcgagtctgctcgaggtgcacctggagaccgggcggacgcaccagatccgcgtgcac
atggcggcgacgaagcacccgctcgtcggcgacacgatgtacggcgccgacccggtgctg
gcctcggagctcgggttgacgcggcagtggctcgacgcggtccggctcggcttcgagcac
ccgcgcacgggggagtgggtcgagttcgaggcgtcctaccccgacgacctgcagcaggcg
ctcgaccgcatccgcgccgcctcggcgtag

DBGET integrated database retrieval system