KEGG   Curtobacterium sp. SGAir0471: C1N91_11005Help
Entry
C1N91_11005       CDS       T05978                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cug  Curtobacterium sp. SGAir0471
Pathway
cug00430  Taurine and hypotaurine metabolism
cug00620  Pyruvate metabolism
cug00640  Propanoate metabolism
cug00680  Methane metabolism
cug01100  Metabolic pathways
cug01120  Microbial metabolism in diverse environments
cug01200  Carbon metabolism
Module
cug_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C1N91_11005
   00640 Propanoate metabolism
    C1N91_11005
  09102 Energy metabolism
   00680 Methane metabolism
    C1N91_11005
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    C1N91_11005
Enzymes [BR:cug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     C1N91_11005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QCR43975
UniProt: A0A4P8STK0
Position
complement(2395281..2396477)
Genome map
AA seq 398 aa AA seqDB search
MTAALVVNSGSSSFKYQLIELEGERTLASGLVERIGESSGAWKHTNALTGESSSNDAASV
PDHAAGFQAMIDAFGKVGPSFDEHPPAVVGHRVVHGGTTFDAATVVTDEVEQQIEDLNSL
APLHNPANLEGIRAAKQVFSDVPHVAVFDTAFHQTMPPHAYTYAIPADLAERYRIRRYGM
HGTSHKYVSEQTAAFLGRPLAELKTIVLHLGNGASAAAIDGGRSIETSMGLTPLEGLVMG
TRSGDLDPAVLIHLHREAGMSFDDLDTMLNKRSGLLGLTGNGDMRDVQDAALRGDDEAEA
ALAVYRHRIRRYVGAYTAQLGGLDAVVFTAGVGENNALLRRRVLAGLEHLGIEVDADRNE
LHSKEARLISTDSSRVAVLVVPTNEELEIARQSAAVAL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcagccctcgtcgtgaactctggttcgagttcgttcaagtaccagctcatcgag
ctcgagggcgagcgcacgctcgcctccgggctcgtcgagcgcatcggtgagtcgtcgggg
gcgtggaagcacaccaacgcactgacgggggagtcgtcgtcgaacgacgccgcatccgtg
cccgaccacgccgccggcttccaggcgatgatcgacgccttcgggaaggtcggaccgtcg
ttcgacgagcacccgcccgcggtcgtcgggcaccgtgtcgtgcacggcgggacaaccttc
gacgcggcgaccgtcgtcaccgacgaggtcgagcagcagatcgaggacctcaacagcctc
gcgccgctgcacaacccggcgaacctcgagggcatccgcgcggcgaagcaggtcttctcc
gacgtgccgcacgtcgccgtcttcgacaccgcgttccaccagacgatgccgccgcacgcc
tacacgtacgcgatcccggccgacctggccgagcgctaccggatccgccgctacgggatg
cacggtacgagccacaagtacgtctccgagcagaccgcggcgttcctcggtcgcccgctg
gccgagctgaagacgatcgtgctgcacctgggcaacggggcgtccgccgcggccatcgac
ggcggtcggtcgatcgagacgtcgatggggctcacgccgctcgagggcctcgtgatgggc
acccgctccggcgacctcgaccccgccgtgctcatccacctgcaccgcgaggccggtatg
tccttcgacgacctcgacacgatgctcaacaagcggtccgggctgctcgggctcaccggc
aacggcgacatgcgcgacgtgcaggacgcggcactccgcggtgacgacgaggcggaggca
gcgctcgccgtgtaccggcaccgcatccgccggtacgtgggcgcgtacacggcgcagctc
ggcgggctcgacgccgtcgtgttcaccgccggcgtgggggagaacaacgcactgctgcgg
cggcgcgtgctcgccggactcgaacacctgggcatcgaggtcgacgccgaccgcaacgag
ctgcactcgaaggaggcccggctcatctcgaccgattcgtcgcgcgtcgccgtgctcgtc
gtcccgacgaacgaggagctcgagatcgcccggcagtcggcggcggtcgcgctgtag

DBGET integrated database retrieval system