KEGG   Curtobacterium sp. SGAir0471: C1N91_12515Help
Entry
C1N91_12515       CDS       T05978                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cug  Curtobacterium sp. SGAir0471
Pathway
cug00030  Pentose phosphate pathway
cug00480  Glutathione metabolism
cug01100  Metabolic pathways
cug01110  Biosynthesis of secondary metabolites
cug01120  Microbial metabolism in diverse environments
cug01130  Biosynthesis of antibiotics
cug01200  Carbon metabolism
Module
cug_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cug_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cug00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C1N91_12515
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C1N91_12515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cug04147]
    C1N91_12515
Enzymes [BR:cug01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     C1N91_12515
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     C1N91_12515
Exosome [BR:cug04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   C1N91_12515
  Exosomal proteins of colorectal cancer cells
   C1N91_12515
  Exosomal proteins of bladder cancer cells
   C1N91_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: QCR44219
UniProt: A0A4P8SUG2
Position
complement(2706943..2708367)
Genome map
AA seq 474 aa AA seqDB search
MSSLQTSLLILGASGDLSKRLLLPGLATLLEVKDDWDVQLVGAGVEDISDEDWKAQVRTS
FENAQASKNEEDEGAQDGGEKLSKRLVDVVNASTYRKADVTDADDLKALLAACDHDPAIY
FALPPAVTEKSCAVLEDLDLPGGTRLALEKPFGTDAESAEHLNDLLHSFLPEERIHRVDH
FLGRSTVLNLLGLRFANRIIEPLLSSAHVDRVDIVYDETLGLEGRARYYDKAGALVDMIQ
SHLLQVMAVVAMEAPASIDADDLRTQKELVLRAVRPWGGDVVAAGKRARYTAGTVGDRSL
PSYVDEDGVDPSLGTETLAQLTLEVANWRWAGVPFTLRSGKALEQQRREIVITFKDSPHV
PNGLTGAERPDKLRIWIAPDEMQLELNVNGPGDPYTIDHTALSVTFNPGRLSAYGEVLAG
VLEGDATLSVRGDSAVQGWRVVEPFLQAWRDGKAPLDEYAAGSAGPDSWDNIDC
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcctccagaccagcctgctcatcctcggagccagcggcgacctgtccaaacga
ctgctgctgcccggtctcgccaccctgctcgaggtcaaggacgactgggacgtccagctc
gtcggggccggtgtcgaggacatctcggacgaggactggaaggcgcaggtacggacgtcg
ttcgagaacgcgcaggcctcgaagaacgaggaggacgagggcgcgcaggacggcggcgag
aagctcagcaagcggctggtcgacgtggtgaacgcctcgacgtaccgcaaggccgacgtc
accgacgcagacgacctgaaggcgctcctggcggcctgcgaccacgacccggcgatctac
ttcgcgctgccgccggccgtgaccgagaagagctgcgccgtcctcgaggacctcgaccta
cccggtggcacgcgcctcgcgctcgagaagcccttcggcaccgacgccgagagcgccgag
cacctcaacgacctgctgcactcgttcctgcccgaagaacggatccaccgcgtcgaccac
ttcctcggccgctccacggtcctcaacctgctcgggctccgcttcgcgaaccgcatcatc
gagccgctgctgtcctcggcgcacgtcgaccgcgtcgacatcgtctacgacgagaccctc
gggctcgagggccgtgcacgctactacgacaaggccggtgccctggtcgacatgatccag
agccacctgctccaggtgatggccgtcgtcgcgatggaggcccccgcgtccatcgatgcc
gacgacctccgcacgcagaaggaactcgtgctccgtgccgtgcggccgtggggcggggac
gtcgtcgcggccgggaagcgcgcccggtacacggcgggcacggtcggcgaccggtcgctg
ccgtcgtacgtcgacgaggacggcgtcgacccgtcgctcggcaccgagaccctcgcgcag
ctgaccctcgaggtcgcgaactggcgctgggcaggcgtgccgttcacgctccgctccggc
aaggcgctcgagcagcagcgccgcgagatcgtcatcaccttcaaggactcgccgcacgtg
ccgaacgggctgaccggggccgagcgtccggacaagctccggatctggatcgccccggac
gagatgcagctcgagctcaacgtgaacggccccggcgacccgtacacgatcgaccacacg
gccctgtcggtgaccttcaacccgggtcggctcagcgcgtacggcgaggtcctggccggg
gtgctcgagggcgatgcgacgctgtcggtgcgcggcgacagcgcggtgcaggggtggcgg
gtcgtcgagccgttcctgcaggcgtggcgcgacgggaaggcgccgctcgacgagtacgcg
gccgggtccgccggtcccgacagctgggacaacatcgactgctga

DBGET integrated database retrieval system