KEGG   Cupriavidus necator NH9: BJN34_00330Help
Entry
BJN34_00330       CDS       T05121                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00480  Glutathione metabolism
cuh00590  Arachidonic acid metabolism
cuh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BJN34_00330
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BJN34_00330
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BJN34_00330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AQV92338
UniProt: A0A1U9UID1
Position
1:80260..80874
Genome map
AA seq 204 aa AA seqDB search
MIRRPLLSSLAAALTLAAASTALLPAPVRAADKPAAAPAATAGACPASLNFTFPRLQDDA
PQNLCQYAGKVVLVVNTASYCGFTPQYEGLEALYARYGARGLVVLGFPSNDFSQEPGSQK
EIADFCYNTYGVKFPMLGKSHVRGSDANPMYALLARQTGTTPKWNFYKYLIGRDGKVVAS
YGSRTTPDDKELLAKIESLLGAQR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcgtcccctgctttccagcctggctgccgccctgacccttgcggcggccagc
accgccctgctgccggcgccggtgcgcgccgccgacaagcccgccgcggcccctgccgct
accgcgggcgcctgccctgcctcgctcaacttcaccttcccgcgcctgcaggacgatgcg
ccgcagaacctgtgccagtacgccggcaaggtggtgctggtggtcaacaccgccagctat
tgcggcttcacgccgcagtacgaagggctggaggcgctgtacgccaggtatggcgcgcgc
ggcctggtggtgctgggcttcccgtccaatgacttctcgcaggagcccggctcgcagaaa
gagatcgcggacttctgctacaacacctacggcgtcaagttcccgatgctcggcaagtcg
catgtgcgcggcagcgatgccaaccccatgtacgcgctgctggccaggcagaccggcacc
acgccgaagtggaatttctacaagtacctgatcggccgcgacggcaaggtggtggccagc
tatggcagccgcaccacgccggacgacaaggaactgctggcgaagatcgaatcgctgctc
ggcgcgcagcgctga

DBGET integrated database retrieval system