KEGG   Cupriavidus necator NH9: BJN34_01135Help
Entry
BJN34_01135       CDS       T05121                                 

Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00670  One carbon pool by folate
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
cuh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BJN34_01135
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     BJN34_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AQV92499
UniProt: A0A1U9UIT0
Position
1:238841..239671
Genome map
AA seq 276 aa AA seqDB search
MQDRYFSFEFFPPKTAEGTEKLRNTRAQLAPLKPKYISVTFGAGGTTQQGTLDAVLEIQR
EGIEAAPHLSCVGSSRESIRAILQQYRDGGIRHIVALRGDMPSGMGEIGEFRYANELVEF
IRAETGDWFNIEVAAYPEYHPQAKSPRHDLDNFVRKVKAGADSAITQYFYNADAYFRFVD
DVRALGVEVPIVPGIMPITNYSQLMRFSEMCGAEVPRWVAKRLEGFGDDRESIRAFGLDV
VTALCERLLAAGVPGLHFYTLNAAGATKAIWQRLKL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaccgctacttcagctttgaattcttcccgcccaagacggcggagggcacggag
aaactgcgcaacacgcgtgcgcagctggctccgctcaagcccaagtacatctcggtgacg
ttcggcgccggcggcaccacgcagcagggcacgctggacgcggtgctcgaaatccagcgc
gaaggcatcgaggccgcaccgcacctgtcgtgcgtgggctcgtcgcgcgagagcatccgc
gcgatcctgcagcagtaccgcgacggcggcatccgccatatcgtcgcgctacgcggcgac
atgccctcgggcatgggcgagatcggcgagttccggtacgccaacgaactggtcgagttc
atccgggccgagaccggcgactggttcaatatcgaagtcgcggcctaccccgagtaccac
ccgcaggccaagtccccgcgccacgatctcgacaacttcgtgcgcaaggtcaaggccggc
gccgactccgccatcacgcaatacttctacaatgccgacgcctacttccgctttgtcgac
gacgtgcgcgcgctgggcgtggaggtgccgatcgtgcccggcatcatgccgatcaccaac
tactcgcagctgatgcgcttctccgagatgtgcggcgccgaagtgccgcgctgggtggcc
aagcggctggagggcttcggcgacgaccgcgaatcgatccgcgccttcggcctggacgtg
gtcaccgcgctgtgcgagcgcctgctggccgcgggcgtgccgggcctgcacttctacacg
ctcaacgcggccggcgccaccaaggcgatctggcagcgtctgaagctgtaa

DBGET integrated database retrieval system