KEGG   Cupriavidus necator NH9: BJN34_02105Help
Entry
BJN34_02105       CDS       T05121                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00450  Selenocompound metabolism
cuh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJN34_02105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cuh03016]
    BJN34_02105
Enzymes [BR:cuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BJN34_02105
Transfer RNA biogenesis [BR:cuh03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BJN34_02105
 Prokaryotic Type
    BJN34_02105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AQV92684
UniProt: A0A1U9UJ28
Position
1:450587..451630
Genome map
AA seq 347 aa AA seqDB search
MTDPIRLTQYSHGAGCGCKISPKVLDVILAGSGAQHLDPRLWVGNASRDDAAVYALDGAD
GERGVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVA
REVVAGGRRACDDAGIPLAGGHSIDAPEPIFGLAVTGLVERAHMKRNDTAMPGCRLYLTK
PLGIGVLTTAEKKGLLRADNCHLARDWMCVLNRPGSAFGRLPGVRAMTDVTGFGLLGHLV
EMADGSGLTARLDYAAVPVLADVVDYIGQGCVPGGTQRNFDSYGHRIAPLTDGQRALLCD
PQTSGGLLVAVEPAGEAAFLAECERLGLALAPIGEMVARAALAVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccatccgcctgacgcagtacagccatggcgcaggctgcggctgcaagatt
tccccgaaagtgctcgacgtgatcctggccggcagcggcgcgcagcacctggacccgcgc
ctgtgggtcggcaatgcctcgcgcgacgatgccgcggtgtatgcgctggacggtgcggac
ggcgagcgcggggtagtgtccaccaccgacttcttcatgcccatcgtcgacgatccgttc
gacttcgggcgcatcgccgccaccaatgccatcagcgacatctatgcgatgggcggcgat
ccgctgatggccatcgccatcctgggctggccggtcaacgtgctgccgcccgaggtggcg
cgcgaggtggtggccggcgggcgccgcgcctgcgacgatgccggcattccgctggcgggc
gggcattcgatcgacgcgcccgagccgatcttcggcctggcggtgaccggcctggtcgag
cgcgcgcacatgaagcgcaacgacaccgccatgcccggctgccggctgtacctgaccaag
ccgctgggcatcggcgtgctgaccacggcggaaaagaagggactgctgcgcgccgataac
tgccacctggcgcgcgactggatgtgtgtgctgaaccgccctggcagcgccttcgggcgg
ctgcccggcgtgcgcgcgatgaccgatgtcaccggcttcggcctgcttggccacctggtg
gagatggccgacggcagtggcctgaccgcgcgcctcgactatgcggcggtgccggtgctg
gccgacgtggtcgactatatcggccagggctgcgtgccgggcggcacccagcgcaacttc
gacagctacgggcaccgcatcgcgccgctcaccgacgggcagcgcgcgctgctgtgcgac
ccgcagaccagcggcggcctgctggtggcggtcgagccagccggcgaagccgcgttcctg
gctgaatgcgagcggctcgggctggcgctggcgccgatcggcgagatggtggcgcgcgca
gcgcttgccgtagagatccggtga

DBGET integrated database retrieval system