KEGG   Cupriavidus necator NH9: BJN34_04215Help
Entry
BJN34_04215       CDS       T05121                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00010  Glycolysis / Gluconeogenesis
cuh00053  Ascorbate and aldarate metabolism
cuh00071  Fatty acid degradation
cuh00280  Valine, leucine and isoleucine degradation
cuh00310  Lysine degradation
cuh00330  Arginine and proline metabolism
cuh00340  Histidine metabolism
cuh00380  Tryptophan metabolism
cuh00410  beta-Alanine metabolism
cuh00561  Glycerolipid metabolism
cuh00620  Pyruvate metabolism
cuh00625  Chloroalkane and chloroalkene degradation
cuh00903  Limonene and pinene degradation
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01120  Microbial metabolism in diverse environments
cuh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJN34_04215
   00053 Ascorbate and aldarate metabolism
    BJN34_04215
   00620 Pyruvate metabolism
    BJN34_04215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJN34_04215
   00561 Glycerolipid metabolism
    BJN34_04215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJN34_04215
   00310 Lysine degradation
    BJN34_04215
   00330 Arginine and proline metabolism
    BJN34_04215
   00340 Histidine metabolism
    BJN34_04215
   00380 Tryptophan metabolism
    BJN34_04215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJN34_04215
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJN34_04215
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJN34_04215
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BJN34_04215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF742
Motif
Other DBs
NCBI-ProteinID: AQV93101
UniProt: A0A1U9ULG7
Position
1:complement(913757..915193)
Genome map
AA seq 478 aa AA seqDB search
MHAQHFVANRLIAPDNGLRIKVFDPSNGEPFAEIARGNATDINVAVHAARQAAEGAWGQM
APAERVRLLNRVAVALIAREEELTVLEARDTGKPLRQARADACAVARYFEFYAGAVDKLH
GQTIPYNPAYTVLTVREPHGVTGHIIPWNYPLQIFGRSVGAALAAGNACVVKPAEDACLS
LLRVAEIAAEAGLPEGALNIITGYGHEAGAALARHPGINHISFTGSPQTGKLVAQLAAEN
HVPVTLELGGKSPQIVFADADLDALVPVVVNGIVQNAGQTCSAGSRLLVERPVYDALLDR
LASVFESLRVGPSELDLECGPLISRKQQQRVWDFVSDAQHAGVAVMAQGQIVAEAPEAGY
YQVPMLFRDVPPAHRLAQEEVFGPLLAAMPFDTEAEAIALANGTPYGLVAGVWTRDGGRQ
LRLAHKLRAGQVFINNYGAGGGVELPFGGTGQSGYGREKGFEALYGFTTLKTIAIRHG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccagcatttcgtcgccaaccgcctgattgcgcccgacaacggcctgcgcatc
aaggtgttcgatccgtccaacggcgagccgttcgccgaaattgcgcgcggcaacgccacc
gatatcaacgtcgccgtccatgcggcacgccaggccgccgaaggcgcctggggccagatg
gccccggccgagcgggtgcgcctgctgaaccgcgtcgccgtggcgctgatcgcccgcgag
gaagaactgaccgtgctggaagcccgcgacaccggcaagccgctgcgccaggcgcgcgcc
gatgcctgcgcggtggcgcgctacttcgagttctacgccggcgcggtcgacaagctgcac
ggccagaccattccctacaaccccgcctacaccgtgctgacggtgcgcgagccgcacggc
gtgaccggccacatcatcccgtggaactacccgctgcagatcttcgggcgcagcgtgggc
gctgcgctggccgccggcaacgcctgcgtggtcaagccggccgaggacgcctgcctgtcg
ctgctgcgcgtggccgagatcgccgccgaggccggcctgcccgaaggcgcgctcaacatc
atcaccggctacggccatgaagccggcgccgcgctggcgcgtcacccgggcatcaaccat
atctcgttcaccggctcgccccagaccggcaagctggtggcccagctggccgccgagaac
cacgtgccggtcacgctggagctgggcggcaagtcgccgcagatcgtctttgccgatgcc
gacctggatgcgctggtgccggtggtggtcaatggcatcgtgcagaatgctggccagacc
tgctcggccggcagccgcctgctggtggaacggccggtctatgacgccctgctggaccgg
ctggcgtcggtgttcgagtcgctgcgcgtgggcccgtccgagctggacctggaatgcggc
ccgctgatcagccgcaagcagcagcagcgcgtgtgggacttcgtttcggatgcacagcat
gccggcgtggccgtgatggcgcagggccagatcgtggccgaagcgccggaggccggctac
tatcaggtgccgatgctgttccgcgacgtgccgccggcgcaccggctggcccaggaagaa
gtgttcggcccgctgctggcggccatgcccttcgacaccgaggccgaggccatcgcgctg
gccaacggcacgccctacgggctggtcgcgggggtctggacccgcgacggcgggcgccag
ctgcgcctggcgcacaagctgcgcgcgggccaggtctttatcaacaactacggtgccggc
ggcggcgtcgagctgcccttcggcggcaccggccagtccggctacggacgcgagaagggc
ttcgaagccctgtacggattcaccacgctgaaaactatcgccattcgacatgggtaa

DBGET integrated database retrieval system