KEGG   Cupriavidus necator NH9: BJN34_04400Help
Entry
BJN34_04400       CDS       T05121                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00430  Taurine and hypotaurine metabolism
cuh00460  Cyanoamino acid metabolism
cuh00480  Glutathione metabolism
cuh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BJN34_04400
   00460 Cyanoamino acid metabolism
    BJN34_04400
   00480 Glutathione metabolism
    BJN34_04400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cuh01002]
    BJN34_04400
Enzymes [BR:cuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BJN34_04400
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BJN34_04400
Peptidases and inhibitors [BR:cuh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BJN34_04400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AQV93137
UniProt: A0A1U9UL10
Position
1:956957..958690
Genome map
AA seq 577 aa AA seqDB search
MEYLGEADPCGTATGIGTTRRAFLAGSAALAGSTVWPAVGQELAQEPAQSGRAGLAHSSA
GMVTSPHGLASQAGLEVLKAGGNAIEAAIAIGAVLSVTYPHFTGLGGDAFLVVSDRGGNV
RTFSGIGQAAAETSGYAGTIPLRGPAAALTAAATVAIWDRAFGFSRDQWGGTQSWSALLA
RATEYAANGFPVTPSQCFWQEFRSADLSGWDGFGRVFMPDGRMPRPGEMFRQPELARTLD
RVATQGGREFYEGDLAGRLAAGLAKAGSPLRGRDLARCQAREEVPLRVAYRDGELLGLRP
PTQGVTTLEIMGILNRFDLSGIPEGSADYYHLLVEAVKLAFLDRNRYVADPDFVDVPVDR
LLSQSNLDAHARRIRMDRAMAWPHVFRPGDTVYIGAADREGRCVSMLQTVYFDWGSGLVV
GDTGVLWHNRGASFSLDPASPNVLQGGKRPFHTLNPGIYLKQGKPHLLYGTQGADGQPQT
LAAVLTRMIDYGMDPLTALRRPRFLLGKTFSDSRDSLKLEQDAGLPVFSELAARGHQLSP
IPAQSQLAGHPGAIRIDAGGQLTGAHDPRSDGRALGV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggaatatctgggcgaggcggatccttgcggtaccgccactggcattggtacgacacgt
cgtgcattcctggctggctcggccgcattggccggtagcacggtatggcccgctgtcggg
caggagttggcgcaggagccggcgcaatccgggcgcgccgggctggcgcattcgtccgcg
ggcatggtcacgagcccgcatggactggccagccaggcggggctggaggtattgaaggcc
ggcggcaacgcgatcgaggcggcgatcgccatcggcgcggtgctgagcgtgacgtatccc
cactttaccggcctggggggcgacgccttcctggtggtcagcgatcgcggcggcaatgtg
cgcacgttctccggcatcggccaggccgcggccgagacctcgggctatgcgggcaccatt
ccgctgcgggggccggcagcggcgctcactgcggcggccacggttgcgatctgggaccgc
gcttttggcttcagccgtgaccagtggggcggcacacagtcgtggtccgcgttgctggcg
cgggccacggagtatgcggccaacggattccccgtcacgccgtcacagtgcttctggcag
gagttccgctcggcggacctgtcgggctgggatggctttggacgggtcttcatgcctgat
ggccgcatgcccaggcccggcgaaatgttccggcagccggagctggcccgcaccctggac
cgcgtcgcgacacagggcggccgcgaattctatgagggcgacctggcagggcgcctcgcc
gccggactggccaaggccggctcgccgttgcgcgggcgggacctggcgcgatgccaggcg
cgcgaggaagtgccgctgcgcgtcgcctaccgcgacggcgagttgcttggcctgcgtccg
cccacgcaaggcgtgaccacgctggaaatcatgggcatcctcaatcggttcgacctgtcg
ggcatccccgagggcagcgcggactactaccacctgctggtcgaggccgtgaagctggcg
ttcctggaccgcaaccgctacgtcgccgatcccgactttgtcgatgtgccggtggaccgg
ctgttgtcccagtccaatctcgatgcccacgcgcgccgtatccgcatggaccgcgccatg
gcgtggccgcatgtgttcaggcccggcgatacggtctacatcggtgccgccgatcgcgag
ggccgctgcgtgagcatgctgcagacggtctatttcgactggggcagtggcctggtcgtc
ggtgataccggcgtgctctggcacaaccgtggcgcatcgttcagcctcgatcccgccagc
cccaacgtgctgcagggcggcaagcggccgttccatacgctcaatcccggcatctacctg
aagcagggcaagccgcacctgctgtacggcacgcagggcgccgacggccagccgcagacg
ctggccgcggtgctgacaaggatgatcgactacggcatggatccgctgacggcgctgcgc
cggccgcgcttcctgctgggcaagaccttctcggacagccgcgacagcctcaagctggaa
caggatgccggcctgccggtgttcagcgagcttgccgcgcgcggccatcagttaagtccg
atccctgcgcaaagccagctggccggccatccgggtgcgatccggatcgatgccggcggg
cagctcaccggtgcgcacgatccgcgcagcgatggcagggcgctgggagtctag

DBGET integrated database retrieval system