KEGG   Cupriavidus necator NH9: BJN34_11340Help
Entry
BJN34_11340       CDS       T05121                                 

Definition
(GenBank) thiamine pyrophosphate-binding protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00290  Valine, leucine and isoleucine biosynthesis
cuh00650  Butanoate metabolism
cuh00660  C5-Branched dibasic acid metabolism
cuh00770  Pantothenate and CoA biosynthesis
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01130  Biosynthesis of antibiotics
cuh01210  2-Oxocarboxylic acid metabolism
cuh01230  Biosynthesis of amino acids
Module
cuh_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cuh_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BJN34_11340
   00660 C5-Branched dibasic acid metabolism
    BJN34_11340
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BJN34_11340
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BJN34_11340
Enzymes [BR:cuh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BJN34_11340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M E1_dh
Motif
Other DBs
NCBI-ProteinID: AQV94480
UniProt: A0A1U9UPE9
Position
1:complement(2493019..2494752)
Genome map
AA seq 577 aa AA seqDB search
MTPANATQTDDSEHGTPLPGGHILVDALLAHGAELAFGVPGESYLAVLDGFHRRRDQMRF
IICRQEGGAAVMAEAYGKLTGRPGLAFCTRGPGATNASIGVHTAFQDSTPMILFIGQVGT
DFMDREAFQEIDYRRMFGQMAKWVAQIDRVERIPEYIARAYQTATSGRPGPVVLALPEDM
LAQTAAVPQLQAYQRVMSWPGEADLARLAEMLDAAERPFVLAGGSGWTPQACADLQAFAE
RFALPVGCAFRGQDLFDNRHPNYAGDVGIGINPALAERVRNADLVLAIGPRLGEMTTGGY
ALIAAPRPAQKLIHVHAGAEELGSVYQADLMVQASMPAIAARLAGLQPAAAPRWQAWTAA
AHADYERYLQPPPFTGQGVDMAEVIRTLDQMLPADAVVTNGAGNYAGWLHRYFRYRPFTS
GGRGQLAPTSGAMGYGVPAAVGAKIAFPQRTVVALAGDGCFLMNGQELATSMQYQAPVIF
IVVNNGMYGTIRMHQEREYPTHVSGTELHNPDFAALARAYGARGATVTTTEAFAPALREA
LAAPVSTLIEIQVDPDVITPRTTLSAIRAQALASQQQ
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggccaatgccacccagactgacgattccgaacacggcacgccgctgccgggc
ggccatatcctggtcgatgcgctgctggcgcacggcgccgagctggccttcggcgtgccg
ggcgaaagctacctggccgtgctggacggcttccaccgccgccgcgaccagatgcgcttc
atcatctgccgccaggagggcggggccgccgtcatggccgaggcctacggcaagctgacc
ggccgccccgggctggccttctgcacgcgcgggccgggcgccaccaatgccagcatcggc
gtgcacaccgccttccaggactcgacaccgatgatcctgttcatcggccaggtcggcacc
gacttcatggaccgcgaggccttccaggaaatcgactaccgccgcatgttcggccagatg
gccaagtgggtggcgcagatcgaccgggtcgaacgcatccccgaatacattgcgcgcgcc
taccagaccgccacgtcgggccgtccgggcccggtggtgctggcgctgcccgaagacatg
ctggcgcagaccgcggcggtgccgcagctgcaggcctaccagcgtgtcatgagctggccg
ggcgaagccgacctggcgcggctggccgagatgctcgacgccgcagagcgtcccttcgtg
ctggccggcggcagcggctggacgccgcaggcctgcgccgacctgcaggcctttgccgag
cgcttcgcgctgccggtgggctgcgccttccgcggccaggacctgttcgacaaccgccat
cccaactacgccggcgatgtcggcatcggcatcaacccggcactggccgagcgcgtccgc
aatgccgacctggtgctggccatcggcccgcggctgggcgagatgacgactggcggctac
gcgctgatcgccgcgccgcggcccgcgcagaagctgatccacgtgcatgccggcgcggag
gagctgggcagcgtgtatcaggccgacctgatggtccaggcgtcgatgccggccatcgcc
gcacgcctggccggcctgcagcccgccgccgcgccgcgctggcaggcgtggacggcagcc
gcgcatgccgactacgagcgctacctgcagccgcctccgttcacggggcagggcgtggac
atggccgaagtcatccgcacgctggaccagatgctgccagccgatgccgtggtgaccaac
ggcgccggcaactatgccggctggctgcaccgttatttccgctatcgcccgttcaccagc
ggcggccgcggccagctggcgccgaccagcggcgccatgggctatggcgttccggccgcg
gttggcgccaagatcgcattcccgcagcgcaccgtggtggcgctggccggcgacggctgc
ttcctgatgaatggccaggaacttgcgacgtcgatgcaataccaggcgccggtgatcttc
atcgtcgtcaacaacggcatgtacggcaccatccggatgcaccaggaacgcgaatacccg
acccatgtatcgggcaccgagctgcacaaccccgactttgccgcgctggcgcgcgcctat
ggcgcgcgcggcgccaccgtgaccacgaccgaagcctttgccccggcattgcgcgaggcc
ctggccgcgccggtgtcgacgctgatcgagatccaggtcgacccggacgtgatcacgccg
cgcaccacgctgagcgccatccgcgcgcaggcgctggccagccagcagcagtga

DBGET integrated database retrieval system