KEGG   Cupriavidus necator NH9: BJN34_11595Help
Entry
BJN34_11595       CDS       T05121                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cuh  Cupriavidus necator NH9
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJN34_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AQV94530
UniProt: A0A1U9UPJ6
Position
1:complement(2547419..2548426)
Genome map
AA seq 335 aa AA seqDB search
MQTIQMSLWVIALLVALALLFDFMNGFHDAANSIATVVSTGVLKPHHAVAMAAMCNVVAI
FIFHLKVAATVGTGTIDVAIVDHYVIFGALVGAIAWNVITWYYGIPSSSSHALIGGLVGA
AVAKSGTGALVGSGLLKTVAFILISPLLGFILGSMMMVIVGWTFFRTPPSRVDRWFRRLQ
LVSASMYSLGHGGNDAQKTIGIIWMLLIASGHVAAGGQPPTWVIVCCYVAIGMGTLFGGW
RIVRTMGQKITKLKPVGGFCAETGGAMTLFFASALGVPVSTTHTITGAIVGVGSAQKMSA
VRWGVAGNIVWAWVLTIPASAFMAAIAWWIGLHIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatacaaatgagcctgtgggtgatcgccctgctggtggcgctcgcgctgctg
ttcgacttcatgaacggcttccacgacgcggccaactcgattgccacggtagtgtccacc
ggcgtgctcaagccgcaccatgcggtggcgatggcggcaatgtgcaacgtcgtcgcgatt
ttcattttccatctgaaggtcgccgcaacggtcgggaccggcaccatcgatgtcgcgatc
gtcgaccattacgttattttcggggcgctggtcggggccatcgcctggaacgtcatcacc
tggtactacggtatcccgtcgtcgtcgtcgcacgcgctgatcggcgggctggtgggcgcc
gcggtggccaagtcaggcaccggtgcgctggtgggcagcggcctgctgaagaccgtggcc
ttcatcctgatctcgccgctgctggggttcatcctcggctcgatgatgatggtgatcgtg
ggctggaccttcttccgcacgccgccgtcgcgcgtggaccggtggttccgccggctgcag
ctggtttcggcttcgatgtacagcctgggccatggcggcaatgacgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccagcggtcatgtggcggccggcggccagccgccg
acctgggtgatcgtctgctgttacgtggccatcggcatgggcacgctgttcggcggctgg
cgcatcgtgcgcaccatgggccagaagatcaccaagctcaagccggtcggcggtttctgc
gccgagacgggcggcgccatgacgctgttctttgcttcggcgctgggcgtgccggtatcg
accacgcatacgatcaccggcgccattgtcggtgtcggctcggcgcagaagatgtcggcg
gtgcgctggggcgtggccggcaatattgtctgggcctgggtgctgacgattccggcatcg
gccttcatggcggcgatcgcatggtggatcgggctgcatatcctgtaa

DBGET integrated database retrieval system