KEGG   Cupriavidus necator NH9: BJN34_18055
Entry
BJN34_18055       CDS       T05121                                 

Definition
(GenBank) dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00230  Purine metabolism
cuh01100  Metabolic pathways
cuh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BJN34_18055
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BJN34_18055
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C Cadherin_5
Other DBs
NCBI-ProteinID: AQV95785
UniProt: A0A1U9UUE9
Position
1:3919611..3921902
AA seq 763 aa
MMTHAVIGHSVKRTDLLDKVTGNAKYVADMPFAGLLFGKMKRCNVAHARIRRIDTSRALA
LPGVKAVLTHENVPRVLHAGSPHPRSASVTCDQYILDDKVRYWGEGVAAVAAISEEIAER
AIELIEVEYETLPAVFTTEDAERSDAPCIHDREPGGNLVLPPVIIKRGDVEAGFAEADFI
LEGIYEGGRPTPAYMEPNVCTTSWDGNGNLTVWISTQTAFMVRGIMAEVLGLPLHKVRVL
VDHMGGGFGAKQDLFQHEFLCALLARETRRPVRMEYTREETFLGGRTRHPARIWLRQGFR
NDGTITARQARVVFNSGAYGSHGPGVTNVGTAAMVSLYRCDNVLLEGRCVYTNSPIAGAF
RGYGVVQTYYALDVQMDEAAEHLGLDPAELKLKNAVREGDIAPSNHPLIGHGLEACIEKG
MELVDWPALRRRPRDTSGPIRTGWGLGCEMHGSSAYPGIKEQGNAIIKMNEDGTVVLLTG
AAGLGTGAHTALAQIVAEELTLPFEAVSVVHGDTDVVPWDIGAFASHTTYMVGKAAQMAA
GEIKRQLFDRAAKLMECEPEALTLTAGVIAVRDRDGPTLTVREAVMPRKGIPAAQLVGTA
TYHPTKSYSFAAHFVEVAVDTETGFITVQQVVPVHDVGKVIHPVAAAGQIEGGIQQGIGH
TLYEDYQIDMRTGRSLNANFVDYKMPLAMDMPPIHTVILEAAPDPGGPFGAKGVGEDPIV
AIGPAIANAVFDAIGVRFRHYPIKPEQVLQALAEKATKAGVIS
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgatgacccacgccgtgatcggacacagcgtcaagcgcaccgacctgctcgacaaggtc
accggcaacgccaaatacgttgccgacatgcccttcgccggcctgctgttcggcaagatg
aagcgttgcaacgtcgcacatgccaggatccgccgcatcgacacctcgcgtgccctggca
ttgccgggggtcaaggccgtgctgacccatgagaacgtgccgcgcgtgctgcacgcggga
tcgccgcacccgcgctccgcctcggtgacctgtgaccagtacatcctggacgacaaggtg
cgctactggggtgaaggcgtggccgcggtcgccgccatcagcgaagaaatcgccgagcgc
gcgatcgagctgatcgaagtcgaatacgaaacgctgcccgccgtcttcaccaccgaggac
gccgagcgctccgacgccccgtgcatccacgaccgcgaacccggcggcaacctggtgctg
ccgccggtgatcatcaagcgcggcgacgtggaagcgggctttgccgaagcggatttcatc
ctggagggcatctacgaaggcggccgccccacccccgcctacatggagcccaacgtctgc
accaccagctgggacggcaacggcaacctgacggtgtggatctccacccagaccgccttc
atggtgcgcggcatcatggccgaggtgctgggcctgccgctgcacaaggtgcgcgtgctg
gtcgaccatatgggcggcggcttcggcgccaagcaggacctgttccagcatgagttcctg
tgcgcactgctggcgcgcgagacgcgccgcccggtgcgcatggaatacacgcgcgaggaa
accttcctcggcgggcgcacgcgccatccggccaggatctggctcaggcaaggcttccgc
aatgacggcaccatcaccgcgcgccaggcccgggtagtgttcaactccggcgcctatggc
tcgcatggccccggcgtgaccaatgtcggcaccgccgccatggtctcgctgtaccgctgc
gacaacgtgctgctggaaggccgctgcgtctacaccaacagccccatcgcgggcgccttc
cgcggctatggcgtggtgcagacctactacgcgctcgacgtgcagatggacgaggcggcc
gagcacctgggcctggaccccgccgaactgaagctgaagaacgccgtgcgcgaaggcgat
atcgcgccgtccaaccatccgctgatcgggcacggcctggaggcctgcatcgagaaaggc
atggagctggtcgactggcccgcgctgcggcgccgcccgcgcgacaccagcggcccgatc
cgcaccggctggggcctgggctgcgagatgcacggcagcagcgcctatcccggcatcaag
gaacagggcaacgccatcatcaagatgaatgaggatggtaccgttgtgctgctgactggt
gcggccggactgggcaccggtgcgcacacggccctcgcacagatcgttgcagaagaactg
accctgccgttcgaagctgtatcggtcgtgcacggcgacaccgacgtcgtcccctgggac
atcggcgcctttgccagccacaccacctatatggtcggcaaggccgcgcagatggcggcg
ggcgagatcaagcgccagctcttcgaccgcgccgcgaagctgatggaatgcgagcccgaa
gccctgacactgaccgccggcgtaatcgccgtgcgcgaccgcgacggccccacgctgacc
gtgcgcgaggctgtgatgccgcgcaagggcatccccgccgcgcaactggtgggcaccgcg
acctatcacccgaccaagtcgtactcgtttgccgcgcattttgtcgaggtggccgtcgat
accgaaaccggcttcatcaccgtgcagcaggtggtgccggtgcatgacgtcggcaaggtg
atccaccctgtagcggccgcggggcagatcgaaggcggtatccagcagggtatcggccac
acgctgtatgaggactaccagatcgacatgcgcaccggccgctcgctcaacgccaacttc
gtcgactacaagatgccgctggcgatggacatgccgcccatccacacggtgatcctggag
gcagcacccgaccccggcggcccgttcggcgccaagggcgtgggcgaggacccgatcgtc
gcgatcgggccggcgattgccaatgcggtgttcgatgccatcggcgtgcgcttccggcac
taccctatcaagccggagcaagtgctgcaggcactggcggagaaggcaacgaaggcaggc
gtcatctcatga

DBGET integrated database retrieval system