KEGG   Cupriavidus necator NH9: BJN34_19380Help
Entry
BJN34_19380       CDS       T05121                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00250  Alanine, aspartate and glutamate metabolism
cuh00330  Arginine and proline metabolism
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BJN34_19380 (putA)
   00330 Arginine and proline metabolism
    BJN34_19380 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cuh03000]
    BJN34_19380 (putA)
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BJN34_19380 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BJN34_19380 (putA)
Transcription factors [BR:cuh03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BJN34_19380 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AQV96038
UniProt: A0A1U9UTL6
Position
1:complement(4174542..4178519)
Genome map
AA seq 1325 aa AA seqDB search
MATTTLGVKLDDASRDRLKRVAQSIDRTPHWLIKQAIFSYLEQIERGHLPYETGAAGSAD
ADSADGAEPVHGDAAPQPFLEFAQSIQPQSVLRAAITSAYRRPETDCVPVLLEQARLPQQ
QAEAAIKMAKTLATRLREQKVGTGREGLVQGLIQEFSLSSQEGVALMCLAEALLRIPDKA
TRDALIRDKISGANWQSHLGQSPSLFVNAATWGLLLTGKLVATHTESGLTKALTRIIGKG
GEPLIRKGVDMAMRLMGEQFVTGETISEALANARKYEAEGFRYSYDMLGEAAMTEADAAR
YLASYEQAIHAIGQASRGRGIYEGPGISIKLSALHPRYSRAQHERVVGELYERLKSLTLL
ARQYDIGINIDAEEADRLEISLDLLERLCFEPELAGWNGIGFVVQGYQKRCPFVIDYLID
LARRSRHRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKVYTDVSYIACARKLLSVPDA
IYPQFATHNAHTLSAIYQIAGHSYYPGQYEFQCLHGMGEPLYDQVVGPAADGKFNRPCRI
YAPVGTHETLLAYLVRRLLENGANTSFVNRIADDTISLDELVADPVAVVEAMHRDEGGLG
LPHPRIPSPRTLYGKSRPNSAGIDLANEHRLASLSSALLAATSERFVAEPMLGAEVPRTA
DAITTPVLNPADHRDVVGQVTEASQADVDAALQAAINAAPIWQATPPDVRAAALERAADL
MEAQMQSLMGIIMREAGKTFSNAIAEVREAVDFLRYYAAEIRRSFDNETHRPLGPVVCIS
PWNFPLAIFTGQVAAALAAGNPVLAKPAEQTPLIAAAAVRLLREAGVPAGAVQLLPGRGE
TVGAALVGDARVKGVMFTGSTEVARILQRNVAGRLDAAGRPIPLIAETGGQNAMIVDSSA
LAEQVVGDVVNSAFDSAGQRCSALRVLCLQEDVADRVLEMLKGAMEELNMANPDRLSTDV
GPVIDDEARGNIVRHIDAMRAKGRRVHQADPNAAQGASCRNGTFVPPTLIELDSIEELKR
EVFGPVLHVVRYPRAALDTMVGQINGTGYGLTLGIHTRIDETISHIVSRAHVGNLYVNRN
IVGAVVGVQPFGGESLSGTGPKAGGPLYLHRLLSVCPQDAVARSVRAADAAGGAEAVGQD
EEAARATEAFRTWARAELPEVAAACERFAEASPSGLAVTLAGPTGERNTYTLLPRERVLC
LAAQEADLALQLGAVLTVGAEAVWLENPVSRGLFARLPKGVQSRVRMVADWTAADTAIDA
VLHHGDSDQLRTVCEQVAARPGPIIGVQGLAHGEPNIALDRLLIERSLSVNTAAAGGNAS
LMTIG
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccactctcggcgtcaagctcgacgacgcctcgcgcgaccgcctcaagcgc
gttgcccaatcgatcgaccgcacgccgcactggctgatcaagcaggccatcttcagctac
ctcgaacagatcgagcgcggccacctgccgtatgagaccggcgctgccggcagcgccgac
gccgatagtgcggatggtgccgagcctgtccatggcgatgccgcgccgcagccgttcctg
gaattcgcccagagcatccagccgcagtcggtgctgcgcgcagccattacctccgcctat
cgccgtcccgagaccgattgcgtgccggtgctgctggagcaggcgcgcctgccgcagcag
caggccgaggccgccatcaagatggccaagacgctggccacgcggctgcgcgagcagaag
gtcggcaccggccgtgagggcctggtgcagggcctgatccaggagttctcactgtcgtcg
caggaaggcgtggcgctgatgtgcctggccgaggccctgctgcgcattcccgacaaggcc
acccgcgacgcgctgatccgcgacaagatcagcggcgccaactggcagtcgcacctgggc
cagagcccgtcgctgttcgtcaacgccgccacctggggcctgctgctgaccggcaagctg
gtcgccacccataccgaatcgggcctgaccaaggcgctcacgcgcatcatcggcaagggc
ggcgagccgctgatccgcaagggcgtggacatggccatgcgcctgatgggcgagcagttc
gtcaccggcgagaccatttccgaggcactggccaacgcgcgcaagtacgaggccgagggc
ttccgctactcctacgacatgctgggcgaggcggccatgaccgaggccgatgccgcccgc
tacctggcctcgtacgagcaggccatccacgccatcggccaggcctcgcgcgggcgcggt
atctacgaaggcccgggcatctcgatcaagctgtcggcgctgcacccgcgctacagccgc
gcgcagcatgagcgcgtggtgggcgagttgtacgagcgcctgaagtcgctgacgctgctg
gcgcgccagtacgacatcggcatcaatatcgacgccgaggaagccgaccgcctggaaatt
tcgctggacctgctcgagcgcctgtgcttcgagcccgagctggccggctggaacggcatc
ggcttcgtggtgcagggctaccagaagcgctgcccgttcgtgatcgactacctgatcgac
ctggcccgccgcagccgccaccgcctgatgatccgcctggtcaagggcgcctactgggac
agcgagatcaagcgcgcccaggtcgacggcctggagggctacccggtctatacgcgcaag
gtctacaccgatgtgtcgtacatcgcctgcgcgcgcaagctgctgtcggtgccggacgcg
atctacccgcagttcgccacgcacaacgcgcatacgctgtcggccatctaccagatcgcc
ggccacagctactatcccggccagtatgagttccagtgcctgcacggcatgggcgagccg
ctgtacgaccaggtagtggggcctgccgccgacggcaagttcaaccgcccgtgccgcatc
tacgcgccggtcggcacgcacgagacgctgctggcctacctggtgcgccgcctgctggag
aacggcgccaatacctcgttcgtgaaccgcatcgccgacgacaccatctcgctggacgag
ctggtggcggatccggtcgccgtggtcgaggccatgcaccgtgacgaaggcgggctgggc
ctgccgcacccgcgcattccgtcgccgcgcacgctgtatggcaagagccgtcccaattcg
gccggcatcgacctggccaacgagcaccgcctggcgtcgctgtcgtcggcgctgctggcc
gccaccagcgagcgcttcgtggccgagccgatgctgggcgccgaggtgccgcgcaccgct
gacgccatcaccaccccggtgctgaatccggccgaccaccgcgacgtagtgggccaggtc
accgaggccagccaggcagacgtcgacgccgcgctgcaggccgctatcaacgccgcgccg
atctggcaggcaacgccgccggacgtgcgcgctgccgcgctggaacgcgccgccgacctg
atggaagcccagatgcagtcgctgatgggcatcatcatgcgcgaggccggcaagaccttc
tccaacgccatcgccgaagtgcgcgaggccgtggacttcctgcgctactacgccgccgag
atccgccgcagtttcgataacgagacccaccgcccgctgggcccggtggtctgcatcagc
ccgtggaacttcccgctggcgatcttcaccggccaggtggccgcggcgctggccgccggc
aacccggtgctggccaagcccgccgagcagaccccgctgatcgccgccgccgccgtgcgc
ctgctgcgcgaagcgggcgtgccggccggcgcggtgcaactgctgccaggccgaggcgag
accgtgggcgccgcgctggtgggggacgcccgcgtcaagggcgtgatgttcaccggctcg
accgaagtcgctcgcatcctgcagcgcaacgtggccgggcgcctggacgccgccggccgc
ccgatcccgctgatcgccgagaccggcggccagaacgcgatgatcgtcgattcgtcggcg
ctggccgagcaggtggtcggcgacgtggtcaactccgccttcgactcggccggccagcgc
tgctcggcgctgcgcgtgctgtgcctgcaggaagacgtggccgaccgcgtgctggaaatg
ctcaagggcgccatggaggaactgaacatggccaaccctgaccgcttgtcgaccgacgtc
ggcccggtgatcgacgacgaagcgcgcggcaatatcgtgcgccatatcgacgccatgcgc
gccaagggccgccgtgtccaccaggccgatcccaatgccgcgcagggggccagctgccgc
aacggcaccttcgtgccgccgacgctgatcgagctggacagcatcgaggaactcaagcgc
gaggtgttcggcccggtgctgcacgtggtgcgctacccgcgcgcggcgctcgacaccatg
gtcggccagatcaatggcactggctacggcctgacgctgggcatccatacccgcatcgac
gagaccatctcgcacatcgtcagccgcgcccatgtgggcaacctgtacgtgaaccgcaat
atcgtcggcgccgtggtcggggtgcagccgttcggcggcgaatcgctgtcgggcaccggc
cccaaggcgggcggcccgctctacctgcaccggctgctgtcggtctgcccgcaggacgcg
gtggcgcgcagcgtgcgcgccgccgatgccgcgggcggcgccgaagccgtgggccaggac
gaagaggccgcgcgtgccacggaagccttccgcacctgggcgcgcgccgagctgccggaa
gtggccgccgcctgcgagcgctttgccgaagcctcgccctcaggcctggcggtgacgctg
gccggccccaccggcgagcgcaacacctacaccctgctgccgcgcgagcgcgtgctgtgc
ctggccgcgcaggaggccgacctggccctgcaactgggcgccgtgctgaccgtcggcgcc
gaggcggtttggctggaaaaccctgtcagccgggggctgtttgcgcgcctgcctaagggc
gtacaatcgcgcgtccgcatggtggccgactggaccgcggcggacacggcaatcgatgcc
gtgctgcaccacggcgattccgaccagttgcgcacggtgtgcgaacaggtggccgcgcgc
cccggtccgatcatcggcgtgcagggcctggcgcacggtgaaccgaatatcgcgctcgac
cgtttgctgatcgagcgctcgctctcggtcaacaccgcggccgcgggcggcaatgccagt
ttgatgacgatcggctga

DBGET integrated database retrieval system