KEGG   Cupriavidus necator NH9: BJN34_30655Help
Entry
BJN34_30655       CDS       T05121                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00071  Fatty acid degradation
cuh00072  Synthesis and degradation of ketone bodies
cuh00280  Valine, leucine and isoleucine degradation
cuh00310  Lysine degradation
cuh00362  Benzoate degradation
cuh00380  Tryptophan metabolism
cuh00620  Pyruvate metabolism
cuh00630  Glyoxylate and dicarboxylate metabolism
cuh00640  Propanoate metabolism
cuh00650  Butanoate metabolism
cuh00900  Terpenoid backbone biosynthesis
cuh01100  Metabolic pathways
cuh01110  Biosynthesis of secondary metabolites
cuh01120  Microbial metabolism in diverse environments
cuh01130  Biosynthesis of antibiotics
cuh01200  Carbon metabolism
cuh01212  Fatty acid metabolism
cuh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJN34_30655
   00630 Glyoxylate and dicarboxylate metabolism
    BJN34_30655
   00640 Propanoate metabolism
    BJN34_30655
   00650 Butanoate metabolism
    BJN34_30655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJN34_30655
   00072 Synthesis and degradation of ketone bodies
    BJN34_30655
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJN34_30655
   00310 Lysine degradation
    BJN34_30655
   00380 Tryptophan metabolism
    BJN34_30655
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BJN34_30655
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BJN34_30655
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BJN34_30655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cuh04147]
    BJN34_30655
Enzymes [BR:cuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BJN34_30655
Exosome [BR:cuh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJN34_30655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQV98233
UniProt: A0A1U9V011
Position
2:complement(2347883..2349085)
Genome map
AA seq 400 aa AA seqDB search
MQEAVIVSTARTPIGKAFRGAFNDTEAPVLGGHVIRAALDKAGVAGEEVDDIVLGIAAQQ
GTQGYNLGRLCAYTAGLPDSVGGMAIDRMCASGLVSIATAAKSIMAGEHTIAVAGGLESI
SLVQNQHKNSYRAQSQAVLAAAPAAYIQMIETAEVVATRYGIARTAQDEYALRSQQLTAA
AQEAGLFDDEIVPLASTRVLFDKAGNAVGSEVVRLARDEGNRADTTLDSLAGLKPVWKGG
QWATEGRHITAGNASQLSDGASASVLMSATEAARRGLRPLGAYRGMAVAGCRPEEMGIGP
VFAIPKLLSAHGLTVGDIGLWEINEAFACQVIYCRDQLGIPADRLNVNGGAIAIGHPFGM
SGARLVGHALLEGRRRGVRYVVVSMCIGGGMGAAGLFEVR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagccgttatcgtttccaccgcgcgcacgccgatcggcaaggcattccgtggc
gctttcaacgacaccgaggcgccggtgctgggcgggcatgtcatccgcgctgcgctcgac
aaggccggggtggcgggggaagaggtcgacgacatcgtgctgggtatcgccgcgcagcag
ggcacgcagggctataaccttggccgcctgtgcgcgtacaccgcaggcctgccggacagc
gtgggaggcatggcgatcgaccgcatgtgcgcctcggggctggtcagtatcgctaccgcc
gcaaagagcatcatggcgggcgagcacaccattgccgtggcgggcggcctggagtcgatc
tcgctggtgcagaaccagcacaagaacagctatcgcgcccagtcgcaggcggtgctggcc
gcggcgcccgcggcctatatccagatgatcgagaccgccgaggtggtggccacgcgctat
ggcatcgcgcgcaccgcgcaggatgagtacgcgctgcgcagccagcaactgacagcggcc
gcgcaagaggccggtttgttcgatgacgagatcgtgcccctcgccagcacgcgcgtgctg
ttcgacaaggccggcaatgcggttggcagcgaggtggtcaggctggcgcgtgacgagggc
aaccgggcggacacgacgctggacagcctggccgggctcaagcccgtatggaagggcggc
caatgggcaacggaaggccggcatatcaccgccggcaatgcctcgcagctctccgatggc
gcgtctgcctcggtgctgatgtcggccacggaagccgcgcgccgtgggctgcggccgctc
ggcgcctaccgtggcatggcggtcgccggctgccgtccggaggagatgggcatcggcccg
gttttcgcgatcccgaagctgttgtcggcgcacgggctgacggtgggcgacatcgggctg
tgggagatcaatgaagcctttgcctgccaggtgatctattgccgcgatcagcttggcatt
ccggccgaccggctcaatgtcaacggtggtgcgatcgcgatcgggcatcccttcgggatg
tcgggggcgcgcctggtcggccatgccttgctggagggacgccgccgtggcgtcaggtat
gtggtggtcagcatgtgcatcggcggcggcatgggcgccgccggtctgttcgaagtgcgc
tag

DBGET integrated database retrieval system