KEGG   Cupriavidus necator NH9: BJN34_31130Help
Entry
BJN34_31130       CDS       T05121                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
cuh  Cupriavidus necator NH9
Pathway
cuh00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cuh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    BJN34_31130
Enzymes [BR:cuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     BJN34_31130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N DUF4081 ApbA Amidohydro_2 Shikimate_DH DUF2452
Motif
Other DBs
NCBI-ProteinID: AQV98328
UniProt: A0A1U9V028
Position
2:complement(2456480..2457253)
Genome map
AA seq 257 aa AA seqDB search
MTDVPALFSLQNQVAIVTGAGKGIGRACALAFAQAGADVALAARTQSDLDAVAERIRAMG
RRAITVVCDVNDEAALDELVRRTLTELGKISLLVNNAGGAGPNDPLRMRPHEFVNVLSRN
VMPAYALIQKVAGPMREAGGGAVVNISSTAARYAQKHFSAYGAAKAALNQVTRNLAQDLA
PHVRINAIEPGTIMTDALAPHLTPERKANMLRLTPLGELGQPEDIAAAAVFLASPAARWI
TGKILGVDGGAETTTWC
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgttcccgctttgttctcgctgcagaaccaggttgccatcgtcaccggcgcc
ggcaaaggcatcggccgcgcctgcgcgctggcgtttgcgcaggccggcgccgatgtcgcg
ctcgctgcgcgcacccagtccgatctcgacgccgtggccgagcggatccgcgcaatgggc
cggcgcgccatcaccgtggtctgcgatgtcaacgacgaggccgcgctcgatgaactggtg
cgccgcacgctgaccgaactcggcaagatctcgttgctggtgaacaatgccggcggcgcc
ggccccaacgatccgctcaggatgcgcccgcatgagttcgtcaatgtgctgagccggaac
gtgatgccggcctatgcgctgatccagaaggtggcagggccgatgcgcgaggccgggggc
ggagcggtggtcaatatttcctccaccgcggcgcgctatgcgcagaagcacttcagcgcc
tacggtgcggccaaggccgccctcaaccaggtgacacgcaacctcgcgcaggacctggcg
ccgcatgtgcgcatcaatgccatcgagcccggcaccatcatgaccgatgcgctggcgccg
cacctgacgccggagcgcaaggccaacatgttgcgcctgacgccgctgggagaactgggc
cagcccgaggacatcgcagcggccgcggtcttcctcgcgtcgccggcggcgcgctggatc
accggcaagatcctgggcgtggacggcggcgcggagaccacgacctggtgctga

DBGET integrated database retrieval system