KEGG   Cronobacter universalis: AFK65_03410Help
Entry
AFK65_03410       CDS       T04063                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
cui  Cronobacter universalis
Brite
KEGG Orthology (KO) [BR:cui00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AFK65_03410 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ALB53758
UniProt: A0A376E161
Position
complement(745224..745601)
Genome map
AA seq 125 aa AA seqDB search
MADSPRVCVQVQSVYIEAQSSPEDERFVFAYTVTVRNLGRTPVQLLGRYWLITNGNGKET
EVQGEGVVGVQPHIQPGGEYQYTSGAVIETPFGTMQGHYEMVDDQGNGFHLDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcaccccgcgtttgcgtacaggtacaaagcgtttatatcgaagcgcagtct
tcaccggaggatgagcgtttcgtctttgcctataccgtcaccgtccgcaatctggggcga
acgcctgttcagttgctgggccgctactggcttatcaccaacggcaacggtaaagagacc
gaagtccagggtgaaggcgtggtaggggttcagccccacatccagcccggcggcgaatac
cagtacaccagcggcgcggtcattgaaacgccgttcggcacgatgcagggccactatgag
atggtggacgatcagggcaacggttttcaccttgatatcccggttttccgtctcgccgtt
cccacactgatccattaa

DBGET integrated database retrieval system