KEGG   Cronobacter universalis: AFK65_07930Help
Entry
AFK65_07930       CDS       T04063                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cui  Cronobacter universalis
Pathway
cui00020  Citrate cycle (TCA cycle)
cui00480  Glutathione metabolism
cui01100  Metabolic pathways
cui01110  Biosynthesis of secondary metabolites
cui01120  Microbial metabolism in diverse environments
cui01130  Biosynthesis of antibiotics
cui01200  Carbon metabolism
cui01210  2-Oxocarboxylic acid metabolism
cui01230  Biosynthesis of amino acids
Module
cui_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cui_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AFK65_07930
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK65_07930
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AFK65_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: ALB54598
UniProt: A0A376EAW8
Position
1736876..1738126
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGEKITAQNSKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQLYGQDVWLPQETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINNKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtgaaaagatcacagcgcaaaacagcaag
ctgaatgtcccccacaacccgatcatcccgttcattgaaggcgacggtatcggcgtggac
gtgacgccggcgatgctgaaagtggtcgacgccgcggttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatctacccagctttatggccag
gatgtctggctgccccaggaaaccctggatctgattcgtgaatatcgcgttgctattaaa
ggcccgctgaccacgccggttggcggcggtattcgctccctcaacgttgccctgcgtcag
gagctggacctttacgtctgcctgcgcccggtacgttactaccagggcaccccgagcccg
gttaaacatccggaactgaccgacatggttatcttccgtgaaaactccgaagacatctac
gccggtatcgagtggaaagccgactccgctgacgctgagaaagtgatcaaattcctgcgt
gaagagatgggcgtgaagaaaatccgcttcccggaacattgcggcatcggcatcaagccg
tgttctgaagaaggcaccaaacgcctggtgcgcgcggcgattgaatacgccatcaccaac
gatcgcgaatccgtgaccctggtgcacaaaggcaacatcatgaaattcaccgaaggcgcg
tttaaagactggggctaccagctggcgcgtgaagagtttggcggcgagcttatcgacggc
ggcccgtgggtgaaaatcaagaacccgaacaacggtaaagagatcgttgtgaaagacgtg
attgccgacgccttcctgcagcagatcctgctgcgtccggcggaatatgacgttatcgcc
tgtatgaacctgaacggcgactacatctctgacgccctggcggcgcaggttggcggcatc
ggcatcgcgccgggcgcgaacatcggcgacgagtgcgcgctgttcgaagcgacccacggc
accgcgccgaaatacgcaggccaggacaaagtgaacccgggctctatcattctctctgcg
gaaatgatgctgcgtcatatggaatggttcgaagccgctgacctgattgttaaaggtatg
gaaggcgctatcaacaacaagaccgtgacctatgacttcgaacgcctgatggaaggcgct
aagctgctgaaatgctcagagtttggcgacgctatcatcgcgaacatgtaa

DBGET integrated database retrieval system