KEGG   Cronobacter universalis: AFK65_10230Help
Entry
AFK65_10230       CDS       T04063                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
cui  Cronobacter universalis
Pathway
cui00250  Alanine, aspartate and glutamate metabolism
cui00650  Butanoate metabolism
cui00760  Nicotinate and nicotinamide metabolism
cui01100  Metabolic pathways
cui01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AFK65_10230
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFK65_10230
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AFK65_10230
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     AFK65_10230
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     AFK65_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: ALB55022
UniProt: A0A376EH49
Position
complement(2207965..2209353)
Genome map
AA seq 462 aa AA seqDB search
MSISPATHAISVNPATGETLAAYPLASAEQVELAVTHVSEGFRRWRASRLDERAQTLRDI
GNALRARSEELAQMITAEMGKPILQARGEVAKSAALCDWYAEHGPAMLATAPTLVENQQA
VIEYRPLGPILAVMPWNFPLWQVMRGAVPILLAGNTYLLKHAPNVMGCALLINEIFEDAG
VPAGVFEVINATNDGVSQAINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLADADLDEAVKAAVAGRYQNTGQVCAASKRFIVEASIADAFTEKFVAAAQQLKMGAP
TDENTFLGPMARFDLRDELHAQVTATLSEGATLLLGGEKVAGAANFYAPTVLGNVTREMT
AFRQELFGPVAAISVARDAEQALELANESEFGLCATVWTADDARAEDFAARLECGGVFIN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKNRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttcccctgccacccacgcgatttccgtaaacccggccaccggcgaaaccctg
gcggcgtacccgctggcgagcgccgaacaggttgagctcgccgttacccacgtcagcgaa
ggctttcgccgctggcgcgccagccgccttgatgagcgcgcgcagacgctgcgtgacatc
ggcaatgcgctgcgcgcgcgcagtgaagagctggcgcagatgatcaccgctgaaatgggc
aaaccgatcctccaggcgcgtggcgaagtggcgaaatccgccgcgctctgcgactggtat
gccgaacacggcccggcgatgctcgcgaccgcgccgacgctggtggaaaaccagcaggcg
gtgattgaataccgcccgctcggtccgatcctcgccgtaatgccgtggaacttccccctg
tggcaggtgatgcgcggcgcggtgccgatcctgctggcgggcaacacttatctactcaag
cacgcgccgaacgtgatgggctgcgcgctgctgattaatgagatttttgaagacgcgggc
gtgccggccggcgtgttcgaagtcattaatgcgaccaacgacggggtgagccaggcgatt
aacgatccgcgtatcgccgccgttaccgtgaccggcagcgtgcgtgcgggtgccgcaatc
ggcgcgcaggcgggcgcggcgctgaaaaaatgcgtgctggagctgggcggttccgatccg
ttcatcgtgctggcggacgccgatctcgacgaagccgttaaagcggcggtggcgggccgc
taccagaacaccggacaggtatgcgccgcctccaagcgttttatcgtggaagccagcatc
gccgatgcctttaccgaaaaattcgtggccgccgcgcagcagctgaaaatgggcgcgccg
accgatgaaaacaccttcctgggcccgatggcgcgttttgatctgcgcgacgagctgcat
gcgcaggtgacggcgacgctcagcgaaggcgcgacgctgctgctgggcggcgagaaagta
gccggggcggcgaatttctacgcgccgacggtgcttggcaacgtgacgcgcgagatgacc
gcgtttcgtcaggagctgttcggaccggtcgctgccatcagcgtggcgcgcgacgccgaa
caggcgctggagctggcgaacgagagcgaatttgggctgtgcgcgaccgtctggaccgcc
gatgacgcccgcgcggaggatttcgcggcgcgtctggagtgcggcggcgtctttattaac
ggctactgcgcgagcgacgcccgcgtggcgttcggcggcgtgaagaagagcggctttggc
cgcgagctgtcccacttcggtctgcatgagttctgcaacattcagaccgtctggaaaaac
cgccgctaa

DBGET integrated database retrieval system