KEGG   Cronobacter universalis: AFK65_10640Help
Entry
AFK65_10640       CDS       T04063                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cui  Cronobacter universalis
Pathway
cui00620  Pyruvate metabolism
cui00630  Glyoxylate and dicarboxylate metabolism
cui01100  Metabolic pathways
cui01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK65_10640
   00630 Glyoxylate and dicarboxylate metabolism
    AFK65_10640
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AFK65_10640
    1.2.1.22  lactaldehyde dehydrogenase
     AFK65_10640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487
Motif
Other DBs
NCBI-ProteinID: ALB55099
UniProt: A0A376EG80
Position
complement(2294660..2296099)
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFVQWQGEAWIDVVNPATEALISRIPDGTAEDARRAIDAAARAQAGW
EALPAIERAGWLRKIAAGIREKAAEISALIVAEGGKTQQLASVEVNFTADYIDYMAEWAR
RYEGEILQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAQIVHEVGLPAGVFNLVLGRGETVGQELAGNPKVALVSMTGSVGAGEKIMAA
AAKNITKVCLELGGKAPAIVMDDADVPLAVKAIVDSRVINTGQVCNCVERVYVQKGIYDR
FVSALGEALSAVTFGDPAAHDDIAMGPLINAAALARVKEKVARAVSEGATVALGGKAVEG
KGYFYPPTLLVDVRQEMSIMHEETFGPVLPVVTFGTLEEAIAMANDSEYGLTSSIYTQSL
ATAMKAINGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgtacaacatcctatgtatatcgacggtcagtttgttcagtggcagggc
gaggcgtggatcgatgtggtcaaccccgccacggaggcgttgatttctcgtatcccggac
ggcactgcagaggacgcgcgccgcgccattgacgccgccgcccgcgcgcaggcgggctgg
gaggcgctgcccgccatcgagcgcgccggatggctgcgtaaaatcgccgctggcatccgc
gaaaaggcggcggaaatcagcgcgctgattgtggccgaaggcggcaaaacgcagcagctc
gcgagcgttgaggtcaactttacggcggattacatcgactatatggccgagtgggcgcgc
cgttatgaaggcgaaatcctgcaaagcgaccggcctggcgaaaatattctggtgtttaag
cgcgcgcttggcgttaccaccggcattctgccgtggaatttcccgttctttctgatcgcc
cgcaaactggcgcctgcgctgattaccggcaacaccattgtgattaaaccgagcgaattc
acgccgaataacgccatcgcgtttgcgcagatcgtgcatgaggtggggctgccggcgggc
gtatttaacctggtgctggggcgcggagaaaccgtcggccaggagctggccggcaacccg
aaagtggcgctggtgagcatgaccggcagcgtcggcgcgggcgaaaaaatcatggcggcg
gctgcgaaaaacatcaccaaagtctgtctggagcttggcggcaaagcgcccgccatcgtg
atggacgatgcggatgtgccgcttgcggtaaaagcgattgtcgattcgcgcgtcattaac
accgggcaggtctgtaactgcgttgagcgcgtctatgtgcagaagggcatttacgaccgt
tttgtcagcgcgcttggcgaggcgctgagcgcggtgacattcggcgatccggcggcgcat
gacgatatcgcgatggggccgctgatcaacgcggctgcgctggcgcgcgtgaaagagaaa
gtggcgcgcgcggtcagcgagggcgcgacggtggcgctcggcggcaaggcggtggaaggc
aaaggctatttctatccgccgacgctgctggtggatgtgcgccaggagatgagcattatg
catgaagagacgttcggcccggtgctgccggtcgtcacgttcgggacgctggaagaggcc
attgcgatggcgaacgacagcgagtacggcctgacgtcgtcaatttatacacagtcgctc
gccaccgccatgaaagcgattaacgggctgaagtttggcgaaacttacatcaaccgtgaa
aacttcgaagcgatgcaggggttccacgcgggctggcgtaaatccggcatcggcggagcg
gatggcaaacacgggctgcatgaatatctgcaaacccaggttgtctatctgcaaagctaa

DBGET integrated database retrieval system