KEGG   Cronobacter universalis: AFK65_11940Help
Entry
AFK65_11940       CDS       T04063                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cui  Cronobacter universalis
Pathway
cui00030  Pentose phosphate pathway
cui00480  Glutathione metabolism
cui01100  Metabolic pathways
cui01110  Biosynthesis of secondary metabolites
cui01120  Microbial metabolism in diverse environments
cui01130  Biosynthesis of antibiotics
cui01200  Carbon metabolism
Module
cui_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cui_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
cui_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFK65_11940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AFK65_11940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cui04147]
    AFK65_11940
Enzymes [BR:cui01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AFK65_11940
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AFK65_11940
Exosome [BR:cui04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AFK65_11940
  Exosomal proteins of colorectal cancer cells
   AFK65_11940
  Exosomal proteins of bladder cancer cells
   AFK65_11940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ALB55340
UniProt: A0A376ELI6
Position
complement(2580504..2581979)
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHPDTRILGVGRADWDKEAYTK
VVREALETFMKEKIDEALWDTLSGRLDFCNLDVNDTAAFTRLGKMLDQKNRVTINYFAMP
PSTFGAICEGLGAAKLNAKPARVVMEKPLGTSLETSREINDQVGKFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDNRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLTADSIRDEKVKVLRSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKTSHTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KDSWQDLPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQTTKLDLSYSETFNESHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADNDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacagcgcaggcgtgcgacttagtgattttcggcgccaaaggcgat
ctggcgcgccgaaaactgttgccttccctgtatcagctggaaaaagcgggccaaatccat
ccggatacccgcattctgggggtaggccgcgcggactgggataaagaagcctataccaaa
gtcgtccgtgaagcgcttgaaaccttcatgaaagagaaaatcgacgaagccctgtgggat
actctcagcggccgcctcgatttctgtaatctggacgtcaatgacaccgccgcgtttact
cgtctcggcaaaatgctggatcagaaaaaccgcgtcactatcaactatttcgcgatgccg
ccaagcacctttggcgcgatttgcgaaggcctcggggcggcgaagcttaacgccaaaccc
gcgcgtgtggtgatggaaaaaccgctcggcacttcgcttgaaacctcccgcgagatcaac
gatcaggtgggtaaattcttcgaagagtgccaggtctaccgtattgaccactacctcggt
aaagagacggtgctgaacctgctggcgctgcgttttgcgaactcgctattcgtcaataac
tgggacaaccgcactatcgaccatgtggaaatcaccgtggccgaagaagtgggcatcgaa
ggccgctggggctatttcgatcaggcgggccagatgcgcgacatgatccagaaccacctg
ctgcaaattctctgcatgattgcgatgtctccgccgtctgatctgaccgccgacagcatt
cgcgacgaaaaagtgaaagtgctgcgctcgctgcgccgtatcgaccgctctaacgtgcgt
gagaaaaccgttcgcggccagtacaccgccggtttcgcccagggcaaaaaagtgccgggc
tatctggaagaagagggcgccaacaagaccagccatacggaaaccttcgtcgctatccgc
gtcgatatcgacaactggcgctgggcgggcgtgccattctacctgcgtaccggcaaacgt
ctgccgaccaaatgctctgaagtggtggtctatttcaaaacgccggagctgaacctgttt
aaagactcctggcaggatctgccgcagaacaagctgactatccgtctgcagccggacgaa
ggcgtggatatccaggtgctgaacaaagtgccggggctggatcacaagcacaacctgcaa
accaccaagctggatctgagttattcggaaacctttaacgaaagccaccttgccgatgcc
tacgagcgtctactgctggaaaccatgcgcggcatccaggcgctgttcgtgcgccgtgat
gaagtggaagaagcctggaagtgggtcgactccatcaccgaagcctgggcggcggacaac
gacgcgccgaaaccgtatcaggccggcacatggggccctgtcgcctcggtggcgatgatt
acccgtgacggccgttcctggaacgagttcgagtaa

DBGET integrated database retrieval system