KEGG   Cronobacter universalis: AFK65_15840Help
Entry
AFK65_15840       CDS       T04063                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cui  Cronobacter universalis
Pathway
cui00071  Fatty acid degradation
cui00280  Valine, leucine and isoleucine degradation
cui00310  Lysine degradation
cui00362  Benzoate degradation
cui00380  Tryptophan metabolism
cui00620  Pyruvate metabolism
cui00630  Glyoxylate and dicarboxylate metabolism
cui00640  Propanoate metabolism
cui00650  Butanoate metabolism
cui00900  Terpenoid backbone biosynthesis
cui01100  Metabolic pathways
cui01110  Biosynthesis of secondary metabolites
cui01120  Microbial metabolism in diverse environments
cui01130  Biosynthesis of antibiotics
cui01200  Carbon metabolism
cui01212  Fatty acid metabolism
cui02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cui00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFK65_15840
   00630 Glyoxylate and dicarboxylate metabolism
    AFK65_15840
   00640 Propanoate metabolism
    AFK65_15840
   00650 Butanoate metabolism
    AFK65_15840
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AFK65_15840
   00072 Synthesis and degradation of ketone bodies
    AFK65_15840
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AFK65_15840
   00310 Lysine degradation
    AFK65_15840
   00380 Tryptophan metabolism
    AFK65_15840
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AFK65_15840
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AFK65_15840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AFK65_15840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cui04147]
    AFK65_15840
Enzymes [BR:cui01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AFK65_15840
Exosome [BR:cui04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFK65_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF840
Motif
Other DBs
NCBI-ProteinID: ALB56059
UniProt: A0A0K2N6B0
Position
complement(3435991..3437169)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGAARTPIGCFQGQLARRSAVELGAVVIEALLARTGLNPQDVDEVILGQVLTAG
AGQNPARQTALNSGLPWSVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTEGRTSAPADSHIIDSLVHDGLWDAFNDYHMGVTAENLAREYNISREHQDAYALA
SQQKARAAIDSGRFRDEIVPVVVEQRLGAPLVVDTDEQPRADTSAEGLARLSPAFDRLGS
VTAGNASSINDGAAAVLMMSASKAQEMGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLNDVDLIEANEAFAAQTLSVGKLLEWDERKVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALAIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtggtaattgtgggtgccgcacgcacgcccattggctgttttcagggccag
cttgcgcgtcgctcggcggtggagctcggcgcggtggtcattgaagcgctgctggcgcgc
accgggcttaatccgcaggatgtcgatgaagtgatcctgggccaggtgctgacggcgggc
gcgggccagaacccggcgcgccagaccgcgctcaacagcggcctgccgtggtccgtgtcg
gcgattaccattaacgacgtgtgcggatctggtctgaaagcgcttcatctggcgacgcag
gccattcagtgcggcgaagcggatgtcgtgatcgccggcggtcaggagaacatgagccgc
gcgccgcatgtactgaccgaagggcgcaccagtgcgcctgctgatagccatattatcgac
agcctggtgcatgacgggctgtgggatgcctttaacgattaccatatgggcgttacggcg
gaaaacctggcgcgcgaatataacatcagtcgcgaacatcaggacgcgtatgcgctcgcg
tcacagcagaaagcgcgcgcggccattgacagcgggcggtttcgtgacgagatcgtgccg
gtggtggtcgagcagcggcttggcgcgccgctggtggtggatactgacgaacagccgcgc
gccgacaccagcgcggaagggctggcgcggctgtcgcccgcctttgacaggctcgggagc
gtcacggcggggaacgcctcgtcaatcaatgacggcgcggcggcggtgctgatgatgagc
gccagtaaggcgcaggagatggggctgccggtcctggcgcgtattcgcgccttcgcaagc
gtcggggtcgatccggcgctgatgggcatcgcgccggtgtacgccacgcgccgctgtctg
gagcgcgcgggctggcagcttaatgatgtcgatcttatcgaagccaacgaggcgttcgcg
gcgcagacgctgtcggtcggcaaactgctggaatgggacgagcgtaaagtcaacgtcaac
ggcggcgcgattgcgctggggcatcctatcggcgcgtccggctgccgcatcctggtctcg
ctggtgcatgagatggtgaaacgcgatgcccgtaaagggcttgccacgctttgcatcggc
ggcgggcagggcgtggcgctggcgattgaacgcgattag

DBGET integrated database retrieval system