KEGG   Corynebacterium ulcerans 131002: CUL131002_0620Help
Entry
CUL131002_0620    CDS       T03899                                 

Gene name
mmdA
Definition
(GenBank) Methylmalonyl-CoA decarboxylase subunit alpha
  KO
K17489  methylmalonyl-CoA carboxyltransferase 12S subunit [EC:2.1.3.1]
Organism
cuj  Corynebacterium ulcerans 131002
Pathway
cuj00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cuj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CUL131002_0620 (mmdA)
Enzymes [BR:cuj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     CUL131002_0620 (mmdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE
Motif
Other DBs
NCBI-ProteinID: AKA96167
UniProt: A0A0E3KTF3
Position
641196..642752
Genome map
AA seq 518 aa AA seqDB search
MSQEPTMSERLDQLAKARHEIELGGGEAKIEKQHEKGKLTARERVAALLDEGTFREIGMF
AKHRTTHFGMDKAVAPADGVVTGSGAIFGRAVHVASQDFTVMGGSAGETQSNKVAAMMEA
SATTGTPFIFINDSGGARVQEGIDSLSGYGKVFYQNVLLSGLVPQVSIISGPCAGGAAYS
PALTDFIIQTRKANMFITGPGVIKSVTGEEVTADALGGADAHMAKAGNIHFIADDDEQAI
LIAQKLLSFLPQNNTEEPPVVEPDPIVTPDEELREIVPVDGKRGYDVRDIISRVVDRGDF
LEVQAGYAQNLVVGFARIVGRTVGIVANQPNVMSGVLDINSSDKGSQFIRFCNAFNIPLV
TFVDVPGFMPGVAQEHGGIIRHGAKMLYAYSAASVPKITVELRKSYGGAHLAMCSKDLGA
DRVFAWPTAEIAVMGAEGAVNVVFRKEIEAAEDKEAKRDELIRLYKETFSTPYMAASRGL
VDDIIDPAETRLHIADALEVLTNKRVVRPAKKHGLGPV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagaacctactatgtctgagcgcctagaccagcttgctaaggctcgtcatgag
atcgagctaggcggcggcgaagccaaaatagaaaagcagcatgagaagggcaaactgacg
gctcgtgagcgcgtcgcagcgcttctcgacgaaggcacattccgcgagatcggcatgttt
gccaagcaccgcaccactcactttggcatggataaagcagtcgcaccggcagacggtgtt
gtcactggctcgggagcgatttttggtcgtgccgtccatgtagcatcgcaggactttacc
gtgatgggtggatcagccggcgagactcagtccaacaaggtcgcagcgatgatggaagct
tctgcgaccactggaactcctttcatcttcatcaacgactccggcggagcgcgcgtacaa
gagggaatcgattccctttcgggctacggcaaggtgttctaccagaacgttcttctttca
ggactcgtgccacaggtttcgatcatctcgggcccatgtgctggaggcgctgcttattcg
ccggctctgactgacttcatcattcagacccgcaaggccaacatgttcatcactggccct
ggcgtgattaagtcggtcaccggtgaagaagttaccgcagatgctctaggcggagcggac
gctcatatggccaaggccggaaacatccacttcattgctgatgatgacgagcaggcgatt
ctcatcgcgcagaagctgttgagcttcttgccgcagaacaatacggaagagccaccggtt
gttgaaccagatccaatcgttactcccgatgaggagctgcgggagatcgttcccgtcgac
ggaaagcgcggctatgacgttcgcgatattatttcgcgcgttgtggaccgtggcgacttc
cttgaggtacaggctggctatgcgcaaaacctggtcgtgggatttgcccgcatcgtaggc
cgtaccgtaggtattgtggctaaccagccaaacgtgatgtccggtgtgctggacatcaac
tcctcggataagggaagccagttcatccgcttctgcaacgcctttaacatcccgctggtg
acttttgtggacgttccaggctttatgccgggtgttgctcaggagcacggtggcatcatc
cgacatggtgccaagatgctgtacgcatactcggcagccagcgtgccaaagatcacggtg
gagctgcgtaaatcctacggcggagcgcacctagctatgtgctcaaaggacctgggagcc
gaccgcgtctttgcatggcccactgcagaaatcgcagtgatgggcgcagaaggcgcagtt
aatgtggtcttccgcaaggagatcgaggccgcagaggataaggaagccaagcgcgatgag
ctcatccgcctgtacaaggagaccttctccactccgtatatggctgcctcccgtggcttg
gtcgatgacatcattgatcccgcagaaacccgactgcatatcgcagacgcgcttgaggtc
ttgaccaataagcgcgtagttcgccctgccaagaagcacggcctaggcccggtataa

DBGET integrated database retrieval system