KEGG   Corynebacterium ulcerans 131002: CUL131002_1519Help
Entry
CUL131002_1519    CDS       T03899                                 

Gene name
idsA
Definition
(GenBank) Geranylgeranyl pyrophosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
cuj  Corynebacterium ulcerans 131002
Pathway
cuj00900  Terpenoid backbone biosynthesis
cuj01100  Metabolic pathways
cuj01110  Biosynthesis of secondary metabolites
cuj01130  Biosynthesis of antibiotics
Module
cuj_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:cuj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CUL131002_1519 (idsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cuj01006]
    CUL131002_1519 (idsA)
Enzymes [BR:cuj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     CUL131002_1519 (idsA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     CUL131002_1519 (idsA)
    2.5.1.29  geranylgeranyl diphosphate synthase
     CUL131002_1519 (idsA)
Prenyltransferases [BR:cuj01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   CUL131002_1519 (idsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AKA97043
UniProt: A0A0E3N4V8
Position
1626780..1627898
Genome map
AA seq 372 aa AA seqDB search
MSRSTTSPQFDARSLAFSEIEPAVEQKLREFFQGRSRKISVIGEPVSRAVTYLEDFVLGG
GKRIRPSYAWAGFLAGNGLEGAEDPEAVLASISSLELIQACALIHDDIIDASDSRRGQPT
VHRTAEARHRDNSWNGDSAHFGESIAILLGDLAFAWADDMFRTSGLSDAAIARTSNAWRG
MRTEVIGGQLLDVFLESAGSESIELAENVNRFKTAAYTIERPLHIGAAIAGADENIVRAL
RDYGRDIGVAYQLRDDLLGVFGNPEVTGKPAGDDLREGKRTVLVAKALELAHAADNADAV
ESIRKGVGTVTEPHDIARLADTIRQTGAEAGVEKRIDELAERGISHLCTADISDDARNIL
VSLANKATARSM
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgttccactacgtcccctcaattcgatgcacgttccttagctttctccgaaatc
gaaccggcggtggaacaaaaactgcgcgaatttttccaaggacgctcccgcaaaatctcc
gtcattggtgagccggtatctcgcgcagtgacttatctggaagattttgtcttaggtggc
ggcaagcggattcgccctagctatgcatgggctggttttttagccggcaacgggctggaa
ggcgcggaagatccggaagccgtattagcgtcgataagctctctcgaactcatccaggcc
tgcgctttaatccacgatgacatcattgatgcctccgattctcgtcgcggacaaccaact
gttcaccgaactgcagaggctcgccatagggataactcttggaatggcgactctgcgcac
ttcggcgagtcgattgcgatcttgcttggtgatcttgcctttgcctgggcagacgatatg
tttaggacttctggactaagcgatgcagctatcgcccggacttctaatgcctggcgtggt
atgcgcacagaagttatcggcggtcagctccttgatgtcttcctagagtctgcgggaagc
gaaagcatcgaacttgcagaaaacgtcaatcgctttaaaactgcggcctacacgattgaa
cgcccgttacacatcggcgctgctatagccggtgccgacgaaaacattgtgcgtgcgctc
cgcgattacggaagagacatcggcgtggcttaccagcttcgcgacgatctactcggcgta
ttcggtaaccccgaggtcacggggaagccagcaggtgacgacctgcgcgagggcaagcgc
actgttctcgtggccaaggctctagagcttgctcacgccgcggataacgcagatgccgtg
gaatccattcggaaaggcgtgggaacggttaccgaaccacacgatattgcgcgtttggcc
gacactattcgtcaaactggcgcagaagctggcgtagaaaaacgcattgatgaactcgca
gaacggggaatttctcacctttgcaccgccgatatcagtgacgacgcacgcaacatactc
gtatctttggctaataaagccacagcccgctcaatgtaa

DBGET integrated database retrieval system