KEGG   Corynebacterium ulcerans BR-AD22: CULC22_00796Help
Entry
CULC22_00796      CDS       T01549                                 

Gene name
glpX
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00010  Glycolysis / Gluconeogenesis
cul00030  Pentose phosphate pathway
cul00051  Fructose and mannose metabolism
cul00680  Methane metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01130  Biosynthesis of antibiotics
cul01200  Carbon metabolism
Module
cul_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_00796 (glpX)
   00030 Pentose phosphate pathway
    CULC22_00796 (glpX)
   00051 Fructose and mannose metabolism
    CULC22_00796 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    CULC22_00796 (glpX)
Enzymes [BR:cul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CULC22_00796 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AEG83509
Position
complement(859079..860188)
Genome map
AA seq 369 aa AA seqDB search
MYGYQESPARKQPSARDLVKFLQNIQAPQEATLMTNLHPEIPDRNLALELVRVTEAAALA
SGRWVGRGMKNEGDGAAVDAMRKLINSVQMRGVVVIGEGEKDEAPMLFNGENVGTGEGAE
VDIAVDPIDGTTLMAEGRPNAISVLAAAERGSMYDPSAVFYMKKIAVGPEAAGSIDIEAP
VAHNINAVAKAKNIAPDQVTVVVLDRPRHADLIKDIREAGAKVRLIRDGDVAGAVAAAQE
TNSVDIMMGTGGTPEGIITACAMKCMGGEIQGMLAPRDDAEADRARSAGHDLSQVLLTND
LVSSDNCFFVATGVTNGDMLRGVSYRANGATTRSLVMRSKSGTIRYIESSHKLQKLQEYS
VVDYSKVTK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggtatcaagaatcccccgctaggaaacaaccctcggcgagggacctcgttaaa
tttctgcagaatatacaggcgccacaggaggccaccctcatgaccaaccttcatccagaa
attccagaccgtaacctagcccttgaactcgtgcgtgtcaccgaggccgcagctttggct
tcagggcgatgggtcggtcgcggaatgaagaacgaaggtgacggcgctgccgtcgatgca
atgcgcaagctcattaattcggtccagatgcgtggcgtcgtggttatcggagaaggtgaa
aaagacgaagctccgatgttgttcaacggtgaaaacgtgggaaccggtgaaggcgccgag
gtggatatcgccgtagaccctatcgacggcaccacgttgatggcagaaggtcgccctaat
gcgatctccgtgctcgctgctgcggaacgcggttccatgtacgacccatcagcagtgttc
tacatgaagaaaatcgcggtgggccccgaggctgcaggctccatcgacatcgaggctccg
gtcgcacacaacatcaatgctgtagcaaaagcaaagaacatcgcacctgatcaggtgact
gttgtggtccttgaccgtcctcgtcatgcagaccttattaaagacatccgcgaggcaggc
gcaaaggtccgactcattcgcgatggtgacgtcgccggcgccgtagcagcagcccaggag
accaactctgtggacatcatgatgggcacgggtggcacccccgagggcatcattactgca
tgcgcaatgaaatgtatgggtggagagatccaaggcatgctcgctcctcgcgatgatgcc
gaggctgaccgcgcacgtagcgcgggtcatgatctcagccaggtccttctcaccaatgac
ctagtcagctccgataactgcttctttgtggcgaccggcgtaaccaacggggatatgctc
cgcggcgtaagctatcgcgcaaatggcgcgaccacgcgctctcttgttatgcgttctaag
tccggaacaattcgctacatcgagtcttcccacaaactgcaaaaactacaggagtattcg
gtcgtcgattactccaaagtaaccaaataa

DBGET integrated database retrieval system