KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01317Help
Entry
CULC22_01317      CDS       T01549                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00010  Glycolysis / Gluconeogenesis
cul00520  Amino sugar and nucleotide sugar metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01130  Biosynthesis of antibiotics
cul01200  Carbon metabolism
Module
cul_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CULC22_01317 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CULC22_01317 (ppgK)
Enzymes [BR:cul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CULC22_01317 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEG84027
Position
1457668..1458420
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGEFVGDRIKILTPKPATPEAVAQTIFRIVTEAEWEG
PVGITLPSVIRNQVALSAANIDKSWINVDVQKLFTKTLGGRNVAVLNDADAAGIAEVTFG
EEQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMLVEGKEAEHLASSAAKDREELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWIPKLTIATPVVPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggtggatctgggattaaaggcgcccgtgtt
gatctggataccggtgaatttgtcggagacaggattaaaattttaacgcccaaacctgcc
acccccgaagcggtcgcccaaacgattttccgcattgttacagaagctgaatgggaagga
ccagtcggaataacgcttccctctgtaatccgaaatcaggtagctctttccgccgctaac
attgacaaatcatggatcaacgttgatgttcagaaactatttaccaaaaccctaggcgga
cgtaacgttgcggtgcttaacgacgccgatgcggcaggcatcgccgaggtcactttcgga
gaagaacaagctcgccgcggctccgccattttgctcactttaggaactggaatcggttcc
gctttctttatcaatggcgtcctattccccaatactgaactaggacacatgctcgtagaa
ggaaaagaagccgagcatctcgcttcatccgcagccaaagaccgtgaagagctaagctat
tccaaatgggccaagcgtgtttctaaagtcctcagcgaatatgaacgtctcttttggcca
gacgtatttatcgtaggcggaggaatctcacgcaaagccgataaatggatccctaagctc
actatcgctacacctgtcgtacctgcaaagctacgcaatactgcaggaatcgtaggagca
gcgatggcggctgaccaaaatatccgcccctag

DBGET integrated database retrieval system