KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01554Help
Entry
CULC22_01554      CDS       T01549                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00020  Citrate cycle (TCA cycle)
cul00310  Lysine degradation
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01130  Biosynthesis of antibiotics
cul01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CULC22_01554 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CULC22_01554 (sucB)
Enzymes [BR:cul01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CULC22_01554 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AEG84264
Position
1723860..1725182
Genome map
AA seq 440 aa AA seqDB search
MAHSVEMPELGESVTEGTITQWLKSVGDTVAVDEPLLEVSTDKVDTEVPSPVAGVLLEVR
FDKDDTVDVGEVIVRIGEPGSEPEAKAEPAKEEPKEEAPKAEEPAKEAPKAEEAPAKEAA
KPVNNQNVPYVTPLVRKLANKHGVDLNKIEGTGVGGRIRKQDVLAAAGQGSEPVAAAAPA
AAAKDPRANWSTKSVDPAKAELIGTTKKVNRIREITAKKMVEALQISAQLTHLQEVDMTN
VATLRKENKPAFIEKYGANLTYLPFFVKAVVEALVLHPNVNASYNAATKEITYHSDVNVA
IAVDTERGLLTPVIHKAQELTLPEIAQAIADLADRARNNKLKPNDLSGATFTVTNIGSEG
ALADTPILVPPQVGILGTAAIQKRPVVITENGSDAIAIRQMCYIPFSYDHQIVDGADAGR
FTATIKDRLEKAKFQDDLNL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgcactccgttgaaatgcctgagctgggcgaatccgtcactgagggaacaattact
cagtggctcaagtctgtcggcgacaccgtcgcagtcgacgagccgttgctcgaggtttcc
actgacaaggttgacaccgaggttccttccccagttgcgggcgttctgttggaggttcgc
ttcgacaaagacgacaccgttgatgtcggcgaggttatcgtccgcatcggcgaaccaggc
tccgaaccagaagccaaggcagaacctgccaaggaagagccaaaggaagaagctcccaag
gcagaagaaccagccaaggaagctcccaaggctgaggaagcacctgctaaggaagctgca
aagccagttaataaccagaatgttccttacgtgaccccattggttcgtaagcttgccaac
aagcatggcgttgatctcaataagatcgaaggaactggtgttggcggtcgcatccgtaag
caggacgtccttgccgcagctggtcaaggatctgagccagttgcagcagcagctcctgct
gccgcggctaaggatcctcgcgctaactggtcaaccaagagcgttgaccctgcaaaggcg
gagctcatcggcaccaccaagaaggtcaaccgcatccgcgagattacggccaagaagatg
gttgaggcactgcagatttctgcacagctcacgcaccttcaagaggtcgatatgaccaac
gttgcaacgctgcgcaaggaaaataagccggcattcatcgaaaagtatggcgctaacctg
acctatctgccgttctttgttaaggccgtggtcgaggctctggtcctacacccgaacgta
aacgcgtcttacaacgctgcaaccaaggaaatcacctaccactctgacgtcaatgtggcg
atcgcagtggacacagagcgtggcctgcttactcctgtgattcacaaggctcaggagctt
acgctgccagaaatcgcccaggctattgctgatctggctgatcgtgctcgtaacaacaag
ctgaagccaaatgatctctccggcgcgaccttcaccgtaaccaacattggctccgaaggt
gctctggcagatacaccaatcttggttccgccacaggtcggtatcttgggtactgctgca
atccagaagcgccccgtagtgatcactgaaaacggttcggacgccatcgcgattcgccag
atgtgctacatcccgttctcctatgaccaccagatcgtagacggtgctgacgcaggtcgc
ttcaccgcaacgattaaggatcgtttggaaaaggctaagttccaggacgacctcaacctc
tag

DBGET integrated database retrieval system