KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01577Help
Entry
CULC22_01577      CDS       T01549                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cul  Corynebacterium ulcerans BR-AD22
Pathway
cul00260  Glycine, serine and threonine metabolism
cul00750  Vitamin B6 metabolism
cul01100  Metabolic pathways
cul01110  Biosynthesis of secondary metabolites
cul01120  Microbial metabolism in diverse environments
cul01230  Biosynthesis of amino acids
Module
cul_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cul00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CULC22_01577 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CULC22_01577 (thrC)
Enzymes [BR:cul01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CULC22_01577 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP PLCC
Motif
Other DBs
NCBI-ProteinID: AEG84287
Position
complement(1749699..1751267)
Genome map
AA seq 522 aa AA seqDB search
MPGSVASSYDIKIDAIGGGSDKKCPSVFFSARAVDASVVAVHYISTRDTSQTPVAFTDIL
LGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALAAEVLKLFVDDIPAADLEAIT
ARAYTTPKFADEEIVPVTKLEDGTYIGHLSEGPTAAFKDMAMQLLGELFEYELRRRKETL
NILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQAQMFGLDDPNIFNIALDGVF
DDCQDVVKAVSSDADFKANNHIGAVNSINWARLMAQVVYYISSWLKVTENNDQKVSFCVP
TGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFKTGEYRVRSAAETHETSSPSMDI
SRASNFERFIFDLLGRDAERCSELFGEQVKAGGFSLADDESFEHAATHYGFASGSSTHAD
RIATIADCYTRRGLMVDPHTADGVKVAREWASQIESPIVCLETALPVKFTDTIVEAVGRG
PEIPERFTGILDAPRHVTDLPNDVAAVKDFILESIARDTAGA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctcagtcgcgagctcatacgatataaaaatcgatgcaattggtgggggtagc
gataagaaatgtccatccgttttcttcagcgctagagccgtcgacgctagtgtagtagcc
gtgcactacatttcgacaagagacacttcccagacccccgtagcgtttactgacatactt
ttgggtggtcttgccccagacggcggtttgtaccttcctgagtattatccgcgtctcgac
gctgccacgttagatacctggcgcggtattctcgcccagcaaggttacgcagcactagcc
gcagaagtgcttaagctctttgtcgacgacatcccggcagcggatctagaagccattact
gcgcgcgcttacacgacgcccaagtttgccgacgaagaaatcgtcccggtgaccaagctc
gaggacggcacttatataggccacctatctgagggaccgaccgctgcattcaaagacatg
gccatgcagcttcttggcgagctctttgaatatgagctacgccggaggaaagagacctta
aacattctgggtgccacctctggcgacacaggatcctctgctgaatacgcgatgcgtggg
cgtgcaggaatccgtgtgttcatgctcacccctaaagaccgcatgacgccattccagcag
gcccagatgtttggtctggatgacccaaatatctttaatatcgcgctagatggcgttttt
gatgattgtcaagacgtggttaaagctgtgtcgtccgacgcggattttaaagcgaacaac
cacattggtgcagtgaactcaattaactgggcccgtttgatggcgcaagtggtctactac
atttcttcgtggctcaaagtaacggagaacaacgatcaaaaagtgagtttctgcgttccc
accggaaactttggcgatatctgtgccggacacattgctaagcaaatggggctgccgatc
gacaggctcatcgttgccaccaatgaaaacgatgttcttgatgagttctttaaaaccggt
gagtaccgtgtgcgctctgcagctgagactcatgagacatcctcgccctcgatggatatt
tctagagcgtccaactttgagcggtttatttttgacctgttaggaagagatgccgagcgc
tgctcagaactctttggggaacaagtaaaagctggcggtttttctcttgccgatgacgaa
tcatttgagcacgctgccacgcattatggttttgcgtcgggtagttccacccacgcagac
cgtatagccaccatcgccgattgctatacgcgccggggcctgatggtggatccgcatacc
gctgatggcgtgaaagtcgcgcgcgagtgggctagccagattgaaagccccatcgtgtgt
ttggagaccgctctacccgtgaaattcacggataccattgtagaagcagtaggacgcggt
cctgagattccagagcgctttactggaatcttggatgcaccacgccatgtcacagatcta
cctaatgatgtggctgcagtgaaggacttcattctagagagtattgctcgagatactgcg
ggtgcttaa

DBGET integrated database retrieval system