KEGG   Corynebacterium ulcerans BR-AD22: CULC22_01734Help
Entry
CULC22_01734      CDS       T01549                                 

Gene name
gpmB
Definition
(GenBank) phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
cul  Corynebacterium ulcerans BR-AD22
Brite
KEGG Orthology (KO) [BR:cul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CULC22_01734 (gpmB)
Enzymes [BR:cul01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     CULC22_01734 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEG84444
Position
complement(1899848..1900594)
Genome map
AA seq 248 aa AA seqDB search
MTRRLILLRHGQTEYNATRRMQGHLDTVLSDAGWSQAEAAADFLATLPIGKIISSDLARA
RDTAAVVGKRLGIDVTTDPRLRETDLGEWQAKTIDEVDTDYPGARAIWRHDATWAPPRGE
SRLDVAHRALPVVDELMQDYHEWDDTSVLIVAHGGTISALTCHLLGLEVGQYPIFSGLNN
TCWAQLTARPEFKDPHTASQEAEEKAYASQLTARFTPETAARAQWYLDGWNMGVSLGRIN
VTPSSQPQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccgtctcatcctgctccgccacggacagactgaatacaacgcgacgcgccgc
atgcaggggcacctcgatactgtgctttccgatgccggttggtcgcaggctgaagcggcg
gcggacttcctagctacacttcccatcggaaaaatcatttcctcggatcttgcgcgcgct
cgcgacacggctgcggtggtgggcaagcgtctcggcatcgacgtgaccaccgaccctcgg
cttcgggaaactgatctaggagaatggcaagccaaaaccatcgacgaggtggataccgat
tatcccggtgcgcgcgctatttggcgtcacgacgccacctgggcgcctccccgtggggaa
tctcgacttgatgtggcacaccgggcgctccccgttgtcgacgagctcatgcaggactac
cacgagtgggatgatacaagcgtgctcatcgtggcccacggtgggacaatcagcgcgttg
acctgtcacctcctaggactggaggtcggccaatacccgatattttcgggcctgaataac
acctgctgggcgcagctcacagcacgccctgagttcaaagacccgcataccgcgagccaa
gaggcggaagaaaaggcctatgcttcccagctgacagcccgttttaccccagagaccgca
gcgcgtgcgcaatggtatctcgacggctggaacatgggcgtgagcctcgggcgcatcaac
gttactccttcatcacaaccgcagtag

DBGET integrated database retrieval system