KEGG   Curtobacterium sp. MR_MD2014: NI26_01390Help
Entry
NI26_01390        CDS       T04180                                 

Definition
(GenBank) transferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00430  Taurine and hypotaurine metabolism
cum00460  Cyanoamino acid metabolism
cum00480  Glutathione metabolism
cum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NI26_01390
   00460 Cyanoamino acid metabolism
    NI26_01390
   00480 Glutathione metabolism
    NI26_01390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cum01002]
    NI26_01390
Enzymes [BR:cum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NI26_01390
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NI26_01390
Peptidases and inhibitors [BR:cum01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NI26_01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AIV39262
UniProt: A0A0N6ZVT1
Position
complement(273019..274914)
Genome map
AA seq 631 aa AA seqDB search
MSTNPAFTTPPTETTRPDLQGTFGMAASTHWIATATAQSVLERGGNAFDAAVAGAFVLHV
VEPHLNGPGGDVTAIFATASDRAPTVLVGQGPAPAGATPEHFRSEGLDLVPGAGALAAAV
PGAVDAWLLLLAEHGTWELADVLAPAIGYARDGHPVAPRVVATIATVQDLFRDHWPSSAE
RWLPGGSVPAAGSMVRNETWASVLERLVQAGSGTVDGEGARVTRIEAARTEWAEGFVAQA
VDAFVRAPHRHASGTDHAGVVRASDLAAFRASTEPATTAEFRGHTIAKTGPWGQGPALLQ
TLRLLDPLDDERLDPSTVLGAHTIAEAQKLALADREAYYGDGDVPMAELLSDAYSDARRA
LIGDRASHELRPGSVSVPAGAMPPLRETYTPRGESIAGVGEPTVPGARGNAVAAPAEDAP
VHEDRGEPIVMETGETRGDTCHIDVVDRWGNIVSATPSGGWLQSSPTIPELGFCLGTRMQ
MTWLEEGTASTLTPGARPRTTLTPTLVLRDGEPVVAMGSPGGDQQDQWQLLFLLRTIVGG
WSPQQAIDAPALHTTSFPGSFWPRTWTPGGLVVEDRLGDDVIAGLEELGHVVTRAGDWSL
GRLSCVTRDPDTGVMGAAANPRGAQGYAAGR
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaaccccgccttcaccaccccgccgacggagaccacccgtccggacctgcag
ggcaccttcgggatggccgcgtcgacgcactggatcgcgaccgcgacggcgcagtcggtc
ctcgagcgcggcggcaacgccttcgacgccgccgtcgccggcgccttcgtcctgcacgtc
gtcgaaccgcacctgaacggacccggtggcgacgtgaccgcgatcttcgcgacggcgtcc
gacagggcaccgaccgtcctcgtgggccagggaccggccccggccggcgcgacgccggag
cacttccggtccgagggcctggacctggtcccgggggcgggcgcgctggcggccgccgtc
cccggtgccgtcgacgcgtggctgctgctcctcgccgagcacggcacgtgggagctcgcc
gacgtcctcgcccccgcgatcgggtacgcccgtgacggccacccggtcgcgccccgcgtg
gtcgcaaccatcgcgaccgtgcaggacctgttccgcgaccactggccgtcctccgccgag
cggtggctgccgggaggctcggtgccggccgccgggtcgatggtgcgcaacgagacctgg
gcctcggtcctggaacggctcgtgcaggcagggtccggcaccgtggacggcgagggcgcg
cgcgtcacgcgtatcgaggccgcccgcaccgagtgggccgagggcttcgtcgcgcaggca
gtcgacgccttcgtccgcgccccgcaccgccacgcgtccggcaccgaccacgccggggtg
gtccgcgcgagcgacctcgcggcgttccgcgcgtcgaccgagcccgcgacgaccgcggag
ttccggggccacacgatcgcgaagaccgggccgtggggccagggtccggcgctcctgcag
accctccgcctgctcgacccactggacgacgagcggctcgatccgtcgaccgtcctcggc
gcgcacacgatcgccgaggcgcagaagctcgcgctcgccgaccgcgaggcgtactacggc
gacggcgacgtcccgatggccgagctgctctccgacgcgtactccgacgcgcgtcgcgcc
ctgatcggtgaccgtgcgtcgcacgagctgcgaccggggtcggtctcggtgcccgcgggt
gcgatgcccccgctgcgtgagacgtacacaccgcgcggcgagtcgatcgccggtgtcggc
gagcccaccgtccccggcgcccgcggcaacgcggtggccgcaccggccgaggatgccccc
gtgcacgaggaccgcggtgagccgatcgtgatggagacgggcgagacccgcggtgacacg
tgccacatcgacgtcgtcgaccgctggggcaacatcgtcagcgcgacgccctccggcggg
tggctgcagtcgtcgccgacgatcccggagctcgggttctgcctcggcacccgcatgcag
atgacctggctcgaggagggcacggcgtccacgctcaccccgggcgctcgaccccgcacg
acgctcaccccgacgctcgtgctccgggacggcgagccggtggtcgcgatgggcagcccg
ggcggcgaccagcaggaccagtggcagctgctcttcctgctccgcacgatcgtcggcggg
tggtccccgcagcaggcgatcgacgcacccgcactgcacacgacgtcgttcccggggtcg
ttctggccccgcacctggaccccgggcggcctcgtcgtcgaggaccgcctcggtgacgac
gtcatcgccgggctcgaggagctcggccacgtcgtcacccgcgccggcgactggtcgctc
ggccgtctgtcgtgcgtgacgcgcgaccccgacaccggcgtcatgggcgccgccgccaac
ccgcgaggagcacagggctatgccgcaggacgctga

DBGET integrated database retrieval system