KEGG   Curtobacterium sp. MR_MD2014: NI26_05010Help
Entry
NI26_05010        CDS       T04180                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00230  Purine metabolism
cum00240  Pyrimidine metabolism
cum01100  Metabolic pathways
cum01110  Biosynthesis of secondary metabolites
cum01130  Biosynthesis of antibiotics
Module
cum_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cum_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
cum_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:cum00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NI26_05010
   00240 Pyrimidine metabolism
    NI26_05010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cum04131]
    NI26_05010
Enzymes [BR:cum01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     NI26_05010
Membrane trafficking [BR:cum04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    NI26_05010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AIV39740
UniProt: A0A0N6ZZY0
Position
1078216..1078635
Genome map
AA seq 139 aa AA seqDB search
MSDLEETLVLVKPDGVARQLTGEVLRRIETKGYEIVDLKMVTASRELLDQHYEEHQGKPF
FEPLVEFMQSGPVVAVRVAGNGVIAGFRSLAGTTDPTSAAPGTIRGDLGRDWGLKVQQNL
VHGSDSPESAARELALWFA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatctcgaagagaccctcgtcctcgtcaagcccgacggcgtcgcccgccagctc
accggagaggtcctccgtcgcatcgagaccaagggctacgagatcgtcgacctcaagatg
gtcacggcgtcgcgtgagctcctcgaccagcactacgaggagcaccagggcaagccgttc
ttcgagccgctcgtcgagttcatgcagtccggcccggtcgtcgccgtgcgcgtcgccggc
aacggtgtgatcgcgggcttccgctcgctcgccggcaccacggacccgacctcggccgcc
ccggggaccatccgtggcgacctcggtcgcgactggggcctcaaggtgcagcagaacctc
gtgcacggctcggactccccggagtcggccgcccgcgagcttgccctctggttcgcctga

DBGET integrated database retrieval system