KEGG   Curtobacterium sp. MR_MD2014: NI26_06425Help
Entry
NI26_06425        CDS       T04180                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cum  Curtobacterium sp. MR_MD2014
Brite
KEGG Orthology (KO) [BR:cum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cum03009]
    NI26_06425
Enzymes [BR:cum01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     NI26_06425
Ribosome biogenesis [BR:cum03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    NI26_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AIV39929
UniProt: A0A0N6ZXL9
Position
1384841..1385770
Genome map
AA seq 309 aa AA seqDB search
MSEQRSLPVPDGLAGERVDAAIAKLLGFSRSFAAEVVAAGGVRVDGVEVGKSDRLHADSW
LEVEWSPKEPPRIVPVEVPGMRVVHDDEDIVVVDKPIGVAAHPSPGWDGPTVPGGLAAAG
FTIATSGAAERAGIVHRLDVGTSGLMVVAKTELAYTHLKRAFKERTVEKVYHALAQGHPD
PTSGTIDAPIGRHPSSDWKFAVTADGKPSVTHYETLEAFRSASLLEVHLETGRTHQIRVH
MAATKHPLVGDTMYGADPVLASELGLTRQWLDAVRLGFEHPRTGAWVEFRAEYPDDLQQA
LDRIRAASA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcagcgttccctgcccgtgcccgacggcctcgccggcgagcgggtcgacgcg
gccatcgcgaagctcctcgggttctcgcgatccttcgcggccgaggtcgtcgcggccggc
ggcgtccgcgtggacggcgtcgaggtcggcaagtccgaccggctgcacgccgactcctgg
ctcgaggtcgagtggtccccgaaggagcccccgcgcatcgtgccggtcgaggtcccgggc
atgcgggtcgtgcacgacgacgaagacatcgtcgtcgtcgacaagccgatcggcgtcgcc
gcgcacccgtcgcccgggtgggacgggccgacggtgcccggtgggctcgccgcggccggc
ttcaccatcgcgacctccggcgccgccgagcgggcggggatcgtgcaccggctcgacgtc
gggacctcgggcctgatggtcgtcgcgaagacggagctcgcgtacacgcacctcaagcgg
gcgttcaaggagcgcaccgtcgagaaggtctaccacgcgctggcgcaggggcatcctgat
ccgacctcgggcaccatcgacgcacccatcggacggcacccgtcgagtgactggaagttc
gcggtcacggccgacggcaagccgagcgtgacgcactacgagacgctcgaggcgttccgg
tcggcgagcctgctcgaggtgcacctggagaccgggcggacgcaccagatccgcgtgcac
atggcggcgacgaagcacccgctcgtcggcgacacgatgtacggcgccgacccggtgctg
gcgtccgagctcggactgacgcggcagtggctcgacgcggtgcgactcgggttcgagcac
ccgcggacgggcgcgtgggtggagttccgggccgagtacccggacgacctgcagcaggcg
ctcgaccgcatccgcgccgcctcggcgtag

DBGET integrated database retrieval system