KEGG   Curtobacterium sp. MR_MD2014: NI26_11185Help
Entry
NI26_11185        CDS       T04180                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cum00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NI26_11185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cum01007]
    NI26_11185
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cum03016]
    NI26_11185
   03029 Mitochondrial biogenesis [BR:cum03029]
    NI26_11185
Enzymes [BR:cum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     NI26_11185
Amino acid related enzymes [BR:cum01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   NI26_11185
Transfer RNA biogenesis [BR:cum03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NI26_11185
 Prokaryotic Type
   Other AARSs
    NI26_11185
Mitochondrial biogenesis [BR:cum03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NI26_11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AIV41571
UniProt: A0A0N7A423
Position
2430412..2431752
Genome map
AA seq 446 aa AA seqDB search
MIERTRIADLAALPDGPVAVAGWVETVRDQKKVQFVVLRDETGAAQLVNPATREAEDGDD
DAQARLAVTNEVSGLAHGTFVHVRGTLKHDERVKLGGLEVKVGSLEVVSAAKPETPIADD
SSLDKRLDWRFLDLRNRKQNLIFRIQTTLEHAFRTYWVERDYIEIHTPKLMASASESRAE
LFQLEYFETTAYLAQSPQNFKQMAQPAGFGAVFEIADAFRADPSFTSRHATEFTSVDAEI
SWVESHADVMAMHEELLVAGFTAVKDKYGKEIEEVFGFEFVVPTAPFPRVTLAEARKIVA
DSGHDVVRADGDLDPEGERRVSAWAKETHGSEFVFVTDYDASIRPYYHMRHADDPTLTNS
YDLLFNGAEISTGAQREHRVDVLEAQAVEKGLDPEELGWYLDFFRYGVPPHGGFGMGLAR
VLMLALHEPSIREVTYLFRGPTRLTP
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaacgcacccgcatcgccgacctcgccgccctccccgacggccccgttgccgtc
gccggctgggtggagaccgtccgcgaccagaagaaggtccagttcgtcgtcctccgcgac
gagaccggcgccgcgcagctggtgaaccccgccacgcgcgaggccgaggacggcgacgac
gacgcccaggcccggctcgccgtcacgaacgaggtctccgggctcgcgcacggcaccttc
gtgcacgtccgcggcaccctgaagcacgacgagcgcgtgaagctcggcgggctcgaggtc
aaggtcggctcgctcgaggtggtcagcgccgcgaagccggagacgcccatcgcggacgac
tcctcgctcgacaagcgtctcgactggcgcttcctcgacctgcgcaaccgcaagcagaac
ctgatcttccgcatccagacgacgctggagcacgcgttccgcacgtactgggtcgagcgc
gactacatcgagatccacaccccgaagctgatggcgtcggcgtccgagtcgcgcgccgag
ctcttccagctcgagtacttcgagaccaccgcctacctggcgcagtccccgcagaacttc
aagcagatggcgcagcccgccggattcggcgcggtgttcgagatcgcggacgcgttccgt
gcggacccgtccttcacgagccgtcacgccaccgagttcacgagcgtcgacgccgagatc
tcgtgggtcgagtcgcacgccgacgtcatggcgatgcacgaggagctcctcgtcgcgggc
ttcaccgccgtcaaggacaagtacggcaaggagatcgaggaggtcttcggcttcgagttc
gtcgtcccgaccgctccgttcccccgcgtcaccctggccgaggcccggaagatcgtcgcc
gacagcggacacgacgtcgtgcgggcggacggcgacctggaccccgagggcgagcgtcgc
gtcagcgcctgggcgaaggagacgcacggctcggagttcgtgttcgtcacggactacgac
gcctcgatccgcccgtactaccacatgcgtcacgccgacgacccgacgctcacgaacagc
tacgacctgctgttcaacggcgccgagatctccacgggtgcccagcgtgagcaccgcgtc
gacgtgctcgaggcgcaggccgtcgagaagggcctcgaccccgaggagctcggctggtac
ctcgacttcttccgctacggcgtcccgccgcacggcggcttcggcatgggcctcgcccgc
gtgctcatgctcgccctgcacgagccgtccatccgcgaggtcacctacctgttccgcgga
ccgacgcgcctgaccccgtag

DBGET integrated database retrieval system