KEGG   Corynebacterium ulcerans 210932: Cul210932_0643Help
Entry
Cul210932_0643    CDS       T03406                                 

Definition
(GenBank) Hypothetical protein
  KO
K17489  methylmalonyl-CoA carboxyltransferase 12S subunit [EC:2.1.3.1]
Organism
cun  Corynebacterium ulcerans 210932
Pathway
cun00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Cul210932_0643
Enzymes [BR:cun01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.1  methylmalonyl-CoA carboxytransferase
     Cul210932_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2381
Motif
Other DBs
NCBI-ProteinID: AIT88605
UniProt: A0A0M4KRX3
Position
659846..660109
Genome map
AA seq 87 aa AA seqDB search
MSESNSEQLAQLVAELSARLDAAEAELKELRKRSDASIPEDVIIAISAAVSAFMGNRGTI
KAVHYSRERTWAAQGRQKVQHHIPGQL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaatcaaacagcgagcaacttgctcaattagtcgcggaactctcagcgcggctt
gatgcggcggaagctgagcttaaagagctgcgtaagcgttccgacgcttccatcccagaa
gacgtcatcattgctatttctgcagcggtgtcagccttcatgggtaatcgcggcacgatt
aaggcagtccattactcccgcgaaagaacgtgggcagcgcagggacgtcagaaggtccag
catcacattccgggtcagctgtag

DBGET integrated database retrieval system