KEGG   Cupriavidus malaysiensis: BKK80_06410Help
Entry
BKK80_06410       CDS       T04978                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
cup  Cupriavidus malaysiensis
Pathway
cup00540  Lipopolysaccharide biosynthesis
cup01100  Metabolic pathways
Module
cup_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BKK80_06410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cup01005]
    BKK80_06410
Enzymes [BR:cup01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BKK80_06410
Lipopolysaccharide biosynthesis proteins [BR:cup01005]
 Unusual sugar
  BKK80_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AOZ05475
Position
1:1489751..1490743
Genome map
AA seq 330 aa AA seqDB search
MTIIVTGAAGFVGSNLVKGLNERGEDNIIAVDNLTRADKFHNLVDCEIRDYLDKEDFLAR
LARGEFGKIRAIFHEGACSDTMETDGRYMMENNFRYTQTLLRHCLDLGAQFLYASSAATY
GASQTFREERAYEKPLNVYGYSKFLFDQVVRRTLPGALSQIVGFRYFNVYGPREDHKGRM
ASVAFHNFNQFRSEGIVKLFGEYGGYAPGGHSRDFISVEDVVKVNLFFLEHPDKSGIFNL
GTGRAQPFNDIATTVVNTLREAEGKPALSLAEMTQEGLLEYIKFPDALRGKYQCFTQSDM
SRLRAAGYDQPFLTVQEGVARYCRWLLQRG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgtgaccggcgctgccggctttgtcggcagcaacctcgtcaagggcctg
aacgagcggggcgaggacaacatcatcgccgtggataacctgacgcgggcggacaagttc
cacaacctcgtcgactgcgagatccgcgactacctcgacaaggaagactttctcgcccgc
ctggcgcgcggcgagttcggcaagatccgcgcgatcttccacgagggcgcctgctccgac
accatggagaccgacgggcgctacatgatggagaacaatttccgctacacccagacgctg
ctgcggcattgcctggacctcggtgcacagttcctctatgcctcgtcggccgccacctat
ggtgcctcgcagaccttccgcgaggagcgggcctacgagaagccgctgaacgtttacggc
tattcgaagttcctgttcgaccaggtggtgcgccgcacgctgccgggtgcgctgtcgcag
atcgtcggcttccgctacttcaatgtctatggtcctcgcgaggaccacaagggccgcatg
gcctcggtggccttccacaacttcaaccagttccgcagcgaaggcatcgtcaagctgttc
ggcgaatacggcggctatgcccccggcggccacagccgcgatttcatttcggtcgaggat
gtggtcaaggtcaacctgttcttcctcgagcatccggacaagtccggcatcttcaacctc
ggcaccggccgcgctcagcccttcaacgatatcgccaccacggtggtcaacacgctgcgt
gaggccgagggcaagccggcgctgagcctggcggaaatgacgcaggaagggctgctcgag
tacatcaagttccctgacgcgctgcgcggcaagtaccagtgcttcacccagtcggacatg
tcgcgcctgcgcgcagccggctatgaccagcccttcctgacggtgcaggaaggcgtggcg
cgctattgccgctggctgctgcagcgcggctga

DBGET integrated database retrieval system