KEGG   Cupriavidus sp. USMAA1020: BKK80_07165Help
Entry
BKK80_07165       CDS       T04978                                 

Definition
(GenBank) acetolactate synthase small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00290  Valine, leucine and isoleucine biosynthesis
cup00650  Butanoate metabolism
cup00660  C5-Branched dibasic acid metabolism
cup00770  Pantothenate and CoA biosynthesis
cup01100  Metabolic pathways
cup01110  Biosynthesis of secondary metabolites
cup01130  Biosynthesis of antibiotics
cup01210  2-Oxocarboxylic acid metabolism
cup01230  Biosynthesis of amino acids
Module
cup_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
cup_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKK80_07165
   00660 C5-Branched dibasic acid metabolism
    BKK80_07165
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BKK80_07165
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BKK80_07165
Enzymes [BR:cup01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BKK80_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: AOZ05604
Position
1:1649691..1650182
Genome map
AA seq 163 aa AA seqDB search
MRHIISVLLENEAGALSRVVGLFSARGYNIETLTVAPTEDQSLSRMTIVTTGSDDVIEQI
TKHLNRLVEVVKVVDLTEGAHIERELMLVKVRAVGKEREEMKRTADIFRGRIIDVTEKTY
TIELTGDGGKLDAFLDAIDRTAILETVRTGGSGIGRGERILKV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatatcatttcggtcctgctggaaaacgaggccggtgcgctgtcgcgcgtggtc
ggcctgttctcggcccgcggctacaacatcgagaccctgaccgtggcgccgacggaagac
cagtcgctgtcgcgcatgaccatcgtcaccaccggctcggacgacgtgatcgaacagatc
accaagcacctgaaccgcctcgtcgaggtggtcaaggtggtcgacctgaccgagggcgcg
cacatcgagcgcgaactgatgctggtcaaggtgcgcgcggtcggcaaggagcgcgaggaa
atgaagcgtaccgccgacatcttccgcggccgcatcatcgatgtcaccgagaagacctat
accatcgagctgaccggcgacggcggcaagctggatgccttcctcgacgccatcgaccgc
accgccatcctggaaacggtgcgtaccggcggttcgggcatcggtcgcggcgaacgcatc
ctcaaggtctga

DBGET integrated database retrieval system