KEGG   Cupriavidus sp. USMAA1020: BKK80_12820Help
Entry
BKK80_12820       CDS       T04978                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00071  Fatty acid degradation
cup00072  Synthesis and degradation of ketone bodies
cup00280  Valine, leucine and isoleucine degradation
cup00310  Lysine degradation
cup00362  Benzoate degradation
cup00380  Tryptophan metabolism
cup00620  Pyruvate metabolism
cup00630  Glyoxylate and dicarboxylate metabolism
cup00640  Propanoate metabolism
cup00650  Butanoate metabolism
cup00900  Terpenoid backbone biosynthesis
cup01100  Metabolic pathways
cup01110  Biosynthesis of secondary metabolites
cup01120  Microbial metabolism in diverse environments
cup01130  Biosynthesis of antibiotics
cup01200  Carbon metabolism
cup01212  Fatty acid metabolism
cup02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKK80_12820
   00630 Glyoxylate and dicarboxylate metabolism
    BKK80_12820
   00640 Propanoate metabolism
    BKK80_12820
   00650 Butanoate metabolism
    BKK80_12820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKK80_12820
   00072 Synthesis and degradation of ketone bodies
    BKK80_12820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKK80_12820
   00310 Lysine degradation
    BKK80_12820
   00380 Tryptophan metabolism
    BKK80_12820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKK80_12820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKK80_12820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKK80_12820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cup04147]
    BKK80_12820
Enzymes [BR:cup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKK80_12820
Exosome [BR:cup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKK80_12820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AOZ06596
Position
1:complement(2898643..2899827)
Genome map
AA seq 394 aa AA seqDB search
MTREVVVVSGVRTAIGTFGGSLKDLAPTELGALVVREALARAKVDGGDVGHVVFGNVIQT
EPKDMYLSRVAAVNGGVTIDAPALTVNRLCGSGLQAIVSAAQTILLGDTDVAIGGGAESM
SRAPYLAPAARWGSRMGDAKLIDMMLGALHDPFHTIHMGVTAENVAKEYDISRAQQDEAA
LESHRRASAAIKAGYFKDQIVPVTLKSRKGDIQFDTDEHVRHDATLDDMTKLKPVFAKEN
GTVTAGNASGLNDAAAAVVLMERAEAERRGLKPLARLVSYGHAGVDPKTMGIGPVPATRK
ALERAGLSVADLDVIEANEAFAAQACAVTKTLGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRVQGRYALVTMCIGGGQGIAAIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgaagtggtggtagtcagcggcgttcgtaccgcgatcggaaccttcggcggc
agcctgaaggacctggccccgaccgagctgggcgccctggtggtgcgtgaagcgctggcc
cgtgccaaagtggacggcggcgacgtcggccatgtggtgttcggcaacgtcatccagacc
gagcccaaggacatgtacctgtcccgcgtggcggccgtcaacggcggcgtcaccatcgac
gcgccggccctgaccgtcaaccgcctatgcggctcgggcctgcaggccatcgtcagcgcg
gcgcagaccatcctgctgggcgataccgacgtggccatcggcggcggtgccgagagcatg
agccgcgctccctacctggcgccggccgcgcgctggggctcgcgcatgggcgatgccaag
ctgatcgacatgatgctgggcgcgctgcacgacccgttccacaccatccacatgggcgtg
accgccgagaacgtcgccaaggagtacgacatctcgcgcgcgcagcaggatgaggctgcg
ctggaatcgcaccgccgcgcttcggcggcgatcaaggcgggctacttcaaggaccagatc
gtccccgtcaccctcaagtcgcgcaagggcgatatccagttcgacaccgacgagcacgtg
cgccatgacgccaccctggacgacatgaccaagctcaagccggtcttcgccaaggagaac
ggcacggtcacggctggcaatgcctcgggcctgaacgacgctgctgccgcggtcgtgctg
atggagcgcgccgaagccgagcggcgcggcctcaagccgctggctcgcctggtctcgtac
ggccacgccggggtcgacccgaagaccatgggtatcggtccggtgccggccacgcgcaag
gcgctggagcgcgcgggcctgtcggtggccgacctggacgtgatcgaggccaacgaagcc
ttcgccgcacaggcgtgcgcggtcaccaagacactgggcctggatcccgccaaggtcaac
ccgaacggttcgggcatttcgctgggccacccgatcggcgccaccggtgcgctgatcacg
gtgaaagccctgtacgagctgcaacgcgtgcaaggccgctacgccctggtgaccatgtgc
atcggcggcggccagggcatcgccgccatcttcgagcgcctgtaa

DBGET integrated database retrieval system