KEGG   Cupriavidus sp. USMAA1020: BKK80_18800Help
Entry
BKK80_18800       CDS       T04978                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
cup  Cupriavidus sp. USMAA1020
Brite
KEGG Orthology (KO) [BR:cup00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BKK80_18800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 CARDB
Motif
Other DBs
NCBI-ProteinID: AOZ07650
Position
1:complement(4155278..4155652)
Genome map
AA seq 124 aa AA seqDB search
MSEYAFSVAVRTQYLPEQSDPERGRHAFAYTITIHNTGEVAAQLISRHWIITDSDNGTQE
VSGLGVVGHQPLLKPGEHFEYTSWATISTPVGSMKGDYFCVAEDGHRFEVPIPEFALVLP
RMLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtacgcgttttccgtggcggtacgcacccagtacctgcccgagcagtccgat
cccgagcgcgggcgccatgccttcgcttacaccatcaccatccacaataccggcgaggtg
gctgcgcagttgatctcgcgccactggatcattaccgacagcgacaacggcacgcaggaa
gtgtccggcctcggcgtggtcgggcaccagccgctgctcaagccgggcgagcatttcgaa
tacaccagctgggccaccatctccaccccggtgggctcgatgaagggcgactacttctgc
gtggccgaggacggccaccgcttcgaggtgccgattcccgagttcgcgctggtgctgccg
cgcatgctgcattga

DBGET integrated database retrieval system